PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00010.407
Common NameAMTR_s00010p00257890, LOC18422295
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 354aa    MW: 37883.9 Da    PI: 7.4337
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00010.407genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP127.51.4e-3967196289
                                       TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                                               ++k+ +++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWLlqqa+pa++++tgt++++a
  evm_27.model.AmTr_v1.0_scaffold00010.407  67 PAKRASNKDRHTKVEGRGRRIRMPATCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTGTIPA 135
                                               6899***************************************************************** PP

                                       TCP  71 sec.eaesssssasnsssg.........................................k 89 
                                               +++  + s +ssa++  ++                                         +
  evm_27.model.AmTr_v1.0_scaffold00010.407 136 NFSsLNISLRSSAASLAAPvlkssyfhpsitqqliarpepwdhdpsrrlmlgssipnlsqQ 196
                                               9997666666666633333554555555555666666666666655555554444444331 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.0E-3972233IPR005333Transcription factor, TCP
PROSITE profilePS5136927.56773127IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010029Biological Processregulation of seed germination
GO:0010229Biological Processinflorescence development
GO:0031347Biological Processregulation of defense response
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
METSEDGNNR RPNFPLQLLE RKEDDTGQVS GFFSGRSGQN SGYFSGEVST SVAASQSESQ  60
ETVKKPPAKR ASNKDRHTKV EGRGRRIRMP ATCAARVFQL TRELGHKSDG ETIEWLLQQA  120
EPAVIAATGT GTIPANFSSL NISLRSSAAS LAAPVLKSSY FHPSITQQLI ARPEPWDHDP  180
SRRLMLGSSI PNLSQQTATN SSHLGLSAQQ LFSKPAFHDS DIDETDSKKR RADLSEQSSI  240
GGYALQAPTV SAGSGQLPAT FWMLASQASS QVGHSGLMQT EPTWTYPSGP GTLYRAGGGL  300
HFMNFPGPVA LPIGSGEVLQ ALNSYAPARH HGPDPDPPPQ SRGHEPTGQD RSE*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved the regulation of plant development. Together with TCP15, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in leaf and floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Involved in the regulation of seed germination. May regulate the activation of embryonic growth potential during seed germination (PubMed:17953649, PubMed:22155632). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). Involved in positive regulation of plant defense. Represses jasmonate (JA) response to promote disease resistance. Regulates the plant immune system by transcriptionally repressing a subset of JA-responsive genes (PubMed:28132837). {ECO:0000269|PubMed:17953649, ECO:0000269|PubMed:21668538, ECO:0000269|PubMed:22155632, ECO:0000269|PubMed:22267487, ECO:0000269|PubMed:24689742, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:25757472, ECO:0000269|PubMed:28132837}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00396DAPTransfer from AT3G47620Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced during seed imbibition (PubMed:17953649). Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:17953649). {ECO:0000269|PubMed:17953649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006827194.10.0transcription factor TCP14
SwissprotQ93Z004e-52TCP14_ARATH; Transcription factor TCP14
TrEMBLW1NG170.0W1NG17_AMBTC; Uncharacterized protein
STRINGERM944310.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26991230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47620.12e-48TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Steiner E, et al.
    The Putative O-Linked N-Acetylglucosamine Transferase SPINDLY Inhibits Class I TCP Proteolysis to Promote Sensitivity to Cytokinin.
    Plant Physiol., 2016. 171(2): p. 1485-94
    [PMID:27208284]
  3. Yang L, et al.
    Pseudomonas syringae Type III Effector HopBB1 Promotes Host Transcriptional Repressor Degradation to Regulate Phytohormone Responses and Virulence.
    Cell Host Microbe, 2017. 21(2): p. 156-168
    [PMID:28132837]
  4. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  5. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]