PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00010.106
Common NameAMTR_s00010p00148880, LOC18422344
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 557aa    MW: 60999.4 Da    PI: 5.4398
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00010.106genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS452.72.3e-1381915521374
                                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset 69 
                                               lv++L++cAeav+++++++a+al++++  la +++ +m+++a++f+eALa+r++r        ++p++t
  evm_27.model.AmTr_v1.0_scaffold00010.106 191 LVHTLMACAEAVQQENMNAAEALVKQIGMLAVSQAGAMRKVATFFAEALARRIFR--------FHPQDT 251
                                               689****************************************************........666665 PP

                                      GRAS  70 seknsseelaalkl.fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpe 137
                                                 +  s+    l++ f+e++P+lkf+h+taNqaIlea++g++rvH+iDf+++qG+QWpaL+qaLa Rp+
  evm_27.model.AmTr_v1.0_scaffold00010.106 252 V-DLFSDI---LQMhFYETCPYLKFAHFTANQAILEAFAGKKRVHVIDFSMKQGMQWPALMQALALRPG 316
                                               4.223333...3334****************************************************** PP

                                      GRAS 138 gppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp..gEalaV 204
                                               gpp +R+Tg+g+p++++++ l+++g++La++Ae+++v+fe++ +va++l+dle  +L+v+p   E++aV
  evm_27.model.AmTr_v1.0_scaffold00010.106 317 GPPAFRLTGIGPPQPDNTDPLQQVGWKLAQLAETIHVEFEYRGFVARSLADLEAYMLDVRPsdVEVVAV 385
                                               *************************************************************999***** PP

                                      GRAS 205 nlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.e 272
                                               n++++lh+ll+++ +l++    vL  v+ l+Pk+v++veqea+hn++ F++rf+eal+yys+lfdsl  
  evm_27.model.AmTr_v1.0_scaffold00010.106 386 NSIFELHNLLAQPSALDK----VLASVRALRPKIVTIVEQEANHNGPVFMDRFTEALHYYSTLFDSLeG 450
                                               **********88888887....*********************************************66 PP

                                      GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                                                +lp+ s++ +++++++lgr+i+n+vacega+r+erhetl +Wr+r+++aGF pv+l+++a  qa++ll
  evm_27.model.AmTr_v1.0_scaffold00010.106 451 CGLPPGSND-QVMSEVYLGRQICNIVACEGADRVERHETLTQWRARMGAAGFAPVHLGSNAFRQASMLL 518
                                               778887765.6778888**************************************************** PP

                                      GRAS 342 rkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                                 ++ +dgy+vee++g+l+l W++rpL+++SaW+
  evm_27.model.AmTr_v1.0_scaffold00010.106 519 TLFSgGDGYKVEENNGCLMLAWHTRPLIATSAWQ 552
                                               *********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.4E-3431104No hitNo description
PfamPF120413.1E-373198IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.714165531IPR005202Transcription factor GRAS
PfamPF035148.1E-136191552IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MKRAQGDSSS GAYRASHGKS KMQEPQDAGV DELLASLGYN VRASDMAEVA QKLEQLEMVM  60
GTAQEDGISH LASETVHYNP SDIATWIESM LTELNFPPNL GAPYAPNPSN NCWTAAELPP  120
PPLPDSNAAE SCSSNLHPPQ LFDSSDFGTS SQISSLVYQS PPREKKRIKA APPPEPRPVV  180
VVDSQETGIR LVHTLMACAE AVQQENMNAA EALVKQIGML AVSQAGAMRK VATFFAEALA  240
RRIFRFHPQD TVDLFSDILQ MHFYETCPYL KFAHFTANQA ILEAFAGKKR VHVIDFSMKQ  300
GMQWPALMQA LALRPGGPPA FRLTGIGPPQ PDNTDPLQQV GWKLAQLAET IHVEFEYRGF  360
VARSLADLEA YMLDVRPSDV EVVAVNSIFE LHNLLAQPSA LDKVLASVRA LRPKIVTIVE  420
QEANHNGPVF MDRFTEALHY YSTLFDSLEG CGLPPGSNDQ VMSEVYLGRQ ICNIVACEGA  480
DRVERHETLT QWRARMGAAG FAPVHLGSNA FRQASMLLTL FSGGDGYKVE ENNGCLMLAW  540
HTRPLIATSA WQIALP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-531915524375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826893.10.0PREDICTED: DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLW1NG330.0W1NG33_AMBTC; Uncharacterized protein
STRINGVIT_14s0006g00640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]