PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00006.141
Common NameAMTR_s00006p00248860, LOC18433928
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 263aa    MW: 27846.9 Da    PI: 8.1455
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00006.141genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-393697263
                                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                                              ++++lkcprCdstntkfCyynny+l qPr+fCk+CrryWtkGG lrnvPvGgg+rknk+sss
  evm_27.model.AmTr_v1.0_scaffold00006.141 36 PTQSLKCPRCDSTNTKFCYYNNYNLCQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKNKRSSS 97
                                              57899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-253492IPR003851Zinc finger, Dof-type
PfamPF027014.3E-323894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.594094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MQDPGTDPLV PAQLRASAAA SCSRLLTHNR RLRPHPTQSL KCPRCDSTNT KFCYYNNYNL  60
CQPRHFCKSC RRYWTKGGVL RNVPVGGGCR KNKRSSSSSQ AAKPSRQPAP PPTAASAALS  120
SSSESSSITG TEPTIGSAQT AGQAGAEQYF NFPAAAPTEI LDTSAEMMNF GGFLPESGSF  180
TSLITGGPSS ANPGMGFGMT ELGFRLQGQP EIGGGNGDLT SRMTAFDWQG NGELDVGNGV  240
EQGFCWGQGQ WGDHDQQGFF FP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047911e-35AP004791.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0491D10.
GenBankAP0149621e-35AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623232.10.0dof zinc finger protein DOF1.7
RefseqXP_011623233.10.0dof zinc finger protein DOF1.7
RefseqXP_020522740.10.0dof zinc finger protein DOF1.7
RefseqXP_020522741.10.0dof zinc finger protein DOF1.7
TrEMBLW1PCS40.0W1PCS4_AMBTC; Uncharacterized protein
STRINGERN057430.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-34OBF binding protein 4
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]