PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00005.66
Common NameAMTR_s00005p00185670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 356aa    MW: 40397.1 Da    PI: 6.5264
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00005.66genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix87.71.3e-2746126286
                                 trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkr 71 
                                              W ++e+++Li +rrem++ ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k+ykk +++++++
  evm_27.model.AmTr_v1.0_scaffold00005.66  46 WIQEEIRTLIGLRREMDTLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEYKKSRHHDRGG 115
                                              ********************************************************************98 PP

                                 trihelix  72 tsessstcpyfdqle 86 
                                              ++    +++y+++le
  evm_27.model.AmTr_v1.0_scaffold00005.66 116 SA----KVSYYKELE 126
                                              44....456999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-436107IPR009057Homeodomain-like
PROSITE profilePS500908.37438102IPR017877Myb-like domain
SMARTSM007174.4E-442104IPR001005SANT/Myb domain
CDDcd122031.37E-2844109No hitNo description
PfamPF138376.2E-2145127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEAVAIGLQP PSALQQHQQQ QAALILTESS GEDHEVKAPK KRAETWIQEE IRTLIGLRRE  60
MDTLFNTSKS NKHLWEQISS KMREKGFDRS PTMCTDKWRN LLKEYKKSRH HDRGGSAKVS  120
YYKELEDLFR ERARNAPYKS PPSKVDSYMQ FADKGFEDAG IPFGSVEGSG RSSLNLERRL  180
DHDGHPLALN GADAVAANNV PPWNWRDTSA NGGENHSTFG RVILVSSGDY SRRIGVDGTA  240
EAIKEAIKSA FGLRTKRTFW LEDEDGVVRS LDRDMPLGTY TLHLDEGLTI KVYDDSDRLS  300
VRTEEKTLYT EDDFRDFLTH RGWTALREFN GFKTVDSLDE LRPNIVYQGL RLLGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A6e-4640124186DNA binding protein GT-1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006845117.20.0trihelix transcription factor GT-1
SwissprotQ9FX531e-165TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLW1PA790.0W1PA79_AMBTC; Uncharacterized protein
STRINGERN067920.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP59331318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-165Trihelix family protein
Publications ? help Back to Top
  1. Le Gourrierec J,Li YF,Zhou DX
    Transcriptional activation by Arabidopsis GT-1 may be through interaction with TFIIA-TBP-TATA complex.
    Plant J., 1999. 18(6): p. 663-8
    [PMID:10417717]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]