PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00004.55
Common NameAMTR_s00004p00074220, LOC18421441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GATA
Protein Properties Length: 279aa    MW: 30700.4 Da    PI: 6.1761
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00004.55genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.92.4e-17213247135
                                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                              C++C +  Tp+WR gp g+ktLCnaCG+++++ +l
  evm_27.model.AmTr_v1.0_scaffold00004.55 213 CTHCLAQRTPQWRAGPLGPKTLCNACGVRFKSGRL 247
                                              *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004019.5E-14207257IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.477207243IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.0E-14208271No hitNo description
Gene3DG3DSA:3.30.50.101.7E-13211245IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.03E-12212263No hitNo description
PfamPF003205.5E-15213247IPR000679Zinc finger, GATA-type
PROSITE patternPS003440213238IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEFGRKVVFS GDPPLGYSFS GELPANKAPE AVPVLSPQSV SDIGSFTSLE EFLPDEKSFS  60
SAEEGNIGLE WLSEFVEDCF SGEIPATHPP VNHFPGPSHM KPLHPVQIPC KARTKRRRRT  120
CHLPVPTPST DESAAYDPPL LHQAYWLAES ELIIQTKPEN EPSNGSTHIL NESLDTNDSN  180
QLVTESDEGV TDLGSESLDR TNESCSSSQP RRCTHCLAQR TPQWRAGPLG PKTLCNACGV  240
RFKSGRLLPE YRPAKSPSFL SYKHSNSHKK VMEMRMAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826302.10.0PREDICTED: GATA transcription factor 4
TrEMBLW1NDV90.0W1NDV9_AMBTC; Uncharacterized protein
STRINGGLYMA16G04670.21e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-36GATA transcription factor 9
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]