PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00004.296
Common NameAMTR_s00004p00270570, LOC18421496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 537aa    MW: 59365.1 Da    PI: 4.9142
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00004.296genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.11.6e-1101545241374
                                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppse 68 
                                               lv+lLl+cAeav  +d +la+++L+++  la+p+gd+mqR+ ++f+ +L +rla  +  +l  +++   
  evm_27.model.AmTr_v1.0_scaffold00004.296 154 LVHLLLACAEAVGCRDSSLANSILSQIWGLANPHGDSMQRVSFCFALGLTTRLALqQNVGLRGSFSNLG 222
                                               68***************************************************9834445555555444 PP

                                      GRAS  69 tsekn..sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasR 135
                                                + +    ++++  ++l+++++P++ f++ +aN aI +a++g++++HiiD+++ + lQWp+L+++LasR
  evm_27.model.AmTr_v1.0_scaffold00004.296 223 LDLELpsKEDKVEGFRLLYQLTPYIAFGFTIANDAIDQAAHGKDALHIIDLGMAHTLQWPPLIRTLASR 291
                                               443335578888999****************************************************** PP

                                      GRAS 136 pegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak.rledleleeLrvkpgEala 203
                                                egpp+lRiTgv+     +++elee  + La  A++lgvpfef+++v   + + l++e+L  ++gEal 
  evm_27.model.AmTr_v1.0_scaffold00004.296 292 LEGPPKLRITGVDVD--PNSKELEENMKVLAMEASSLGVPFEFQLIVGPlSPSLLNMETLGSREGEALF 358
                                               *************93..3999************************876668899*************** PP

                                      GRAS 204 VnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                                               Vn+++ lh+ ++es  + +   ++L+ +++l+P+++++veqea+hn++ Fl rfle+l+yysa+fdsle
  evm_27.model.AmTr_v1.0_scaffold00004.296 359 VNSIMYLHKHVKESRGSLK---SILQSIRKLNPTLFTLVEQEANHNGPFFLGRFLESLHYYSAIFDSLE 424
                                               **********987766665...8********************************************** PP

                                      GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                                               a+lpr s +r+k+Er  +++ei++++a eg +r+erhe++ +Wr++l++aGF+ v l++  ++qa+++l
  evm_27.model.AmTr_v1.0_scaffold00004.296 425 ASLPRPSPQRMKIERSHFAEEIRDIIAYEGLKRVERHERADQWRRQLGRAGFQVVGLKS--MSQARMML 491
                                               ********************************************************976..99****** PP

                                      GRAS 342 rkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                               + ++ dgy++  e+g lvlgWk+r+++ +S W+
  evm_27.model.AmTr_v1.0_scaffold00004.296 492 SVYGCDGYTLATEKGGLVLGWKGRSIMLASTWQ 524
                                               ********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.335128506IPR005202Transcription factor GRAS
PfamPF035145.5E-108154524IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MEQWLQTPSH ASIGHDTAIR KYCSERLEQE QQGDSDEASN ELEMWSSSGT NSPSLAAAEQ  60
VEFVDGLINM EWCYEEDGNL ASKCGFASHS ETVTISRNYG IEEFMALLTP GSSIEEEIDV  120
ISSIEPTNSE SLIPPHDGDA MNEMSQGVDE GLHLVHLLLA CAEAVGCRDS SLANSILSQI  180
WGLANPHGDS MQRVSFCFAL GLTTRLALQQ NVGLRGSFSN LGLDLELPSK EDKVEGFRLL  240
YQLTPYIAFG FTIANDAIDQ AAHGKDALHI IDLGMAHTLQ WPPLIRTLAS RLEGPPKLRI  300
TGVDVDPNSK ELEENMKVLA MEASSLGVPF EFQLIVGPLS PSLLNMETLG SREGEALFVN  360
SIMYLHKHVK ESRGSLKSIL QSIRKLNPTL FTLVEQEANH NGPFFLGRFL ESLHYYSAIF  420
DSLEASLPRP SPQRMKIERS HFAEEIRDII AYEGLKRVER HERADQWRRQ LGRAGFQVVG  480
LKSMSQARMM LSVYGCDGYT LATEKGGLVL GWKGRSIMLA STWQVHSASP SNKTHE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-6114952714382Protein SCARECROW
5b3h_A1e-6114952713381Protein SCARECROW
5b3h_D1e-6114952713381Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826543.10.0DELLA protein RGL1
TrEMBLW1NF640.0W1NF64_AMBTC; Uncharacterized protein
STRINGERM937800.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70521119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-73RGA-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]