PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00002.671
Common NameAMTR_s00002p00272200, LOC18429680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family B3
Protein Properties Length: 495aa    MW: 56140.8 Da    PI: 6.897
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00002.671genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.91.2e-15361171098
                                               HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
                                        B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                                                +++  l lp +  ++++g+   s   +le++sg+ W v+l  +k+ ++ ++++GWkeF k + +k g+
  evm_27.model.AmTr_v1.0_scaffold00002.671  36 DFSK-ELALPQELYKHINGVA--SERAILESPSGKLWLVEL--KKTEEGAFFQNGWKEFIKGHSVKLGE 99 
                                               3444.599******9999895..557***************..************************** PP

                                               EEEEEE-SSSEE..EEEEE- CS
                                        B3  79 fvvFkldgrsefelvvkvfr 98 
                                               ++vF++dg+ +f   v++f 
  evm_27.model.AmTr_v1.0_scaffold00002.671 100 SIVFRYDGNLRF--DVQIFG 117
                                               ******997666..888876 PP

2B358.11.6e-18386475498
                                               E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHH CS
                                        B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkan 72 
                                               +++ps+v     l +p++fa+ h  +k +   + l+d++gr+Wev + +++ ++++ l++GW  F   n
  evm_27.model.AmTr_v1.0_scaffold00002.671 386 AMKPSNVYHCFYLHIPRSFAKMHL-PKVR-LAMHLRDPTGREWEVIC-ICREGNATALSGGWAAFSIGN 451
                                               688999999999********9993.4444.48***************.58888899************* PP

                                               T--TT-EEEEEE-SSSEE..EEEEE- CS
                                        B3  73 gLkegDfvvFkldgrsefelvvkvfr 98 
                                               +L+egD+++F+l++  e+ + v++fr
  evm_27.model.AmTr_v1.0_scaffold00002.671 452 NLEEGDVCIFELKE--EKLMAVHIFR 475
                                               ***********865..4447899988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.8E-2026120IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.14226119IPR003340B3 DNA binding domain
SuperFamilySSF1019365.69E-2026120IPR015300DNA-binding pseudobarrel domain
CDDcd100171.14E-1427116No hitNo description
SMARTSM010193.7E-1329119IPR003340B3 DNA binding domain
PfamPF023622.8E-1329116IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-25375475IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.27E-26376475IPR015300DNA-binding pseudobarrel domain
CDDcd100179.53E-24381475No hitNo description
SMARTSM010195.4E-18383477IPR003340B3 DNA binding domain
PROSITE profilePS5086313.662383477IPR003340B3 DNA binding domain
PfamPF023621.4E-16385475IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0034613Biological Processcellular protein localization
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MEDYRTCSNC ELHCHKVDPF QVFKTRPRFL KEMAGDFSKE LALPQELYKH INGVASERAI  60
LESPSGKLWL VELKKTEEGA FFQNGWKEFI KGHSVKLGES IVFRYDGNLR FDVQIFGSNG  120
YQREDMFIAN TCKKSTSNEG EGELNEAIDA ASIKSCKSYA KRKLKFLLMN NFTPPVAKEQ  180
DMGVDNHEQC VDVSQTRDCK DHEKRKLSSY QSKLCKKHVR PRKLTETGDS MESTPMTPTE  240
DHLVVQNEII ACPQEETVGK PDDADESVLH RESGDPKNLT ENGDSTESTP LTLYEDLVQN  300
QILVSPQEEN VTRTNERVLS SRTDGYTKEK KESIDVVRTH IPKQTSSPKF LRKFQSGRRV  360
VTLDEKARAL EAANSFKTNN PRCVIAMKPS NVYHCFYLHI PRSFAKMHLP KVRLAMHLRD  420
PTGREWEVIC ICREGNATAL SGGWAAFSIG NNLEEGDVCI FELKEEKLMA VHIFRVVEEI  480
VPLIRCLEPI SAGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-1834948015146B3 domain-containing transcription factor VRN1
4i1k_B4e-1834948015146B3 domain-containing transcription factor VRN1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00192DAPTransfer from AT1G49480Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006839026.10.0B3 domain-containing protein Os01g0723500 isoform X1
TrEMBLW1P3Q70.0W1P3Q7_AMBTC; Uncharacterized protein
STRINGERN015950.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.13e-20related to vernalization1 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]