PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00002.637
Common NameAMTR_s00002p00271710, LOC18429646
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family CPP
Protein Properties Length: 897aa    MW: 97941.5 Da    PI: 6.2658
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00002.637genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.53.5e-15577616342
                                       TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                                               +k+CnCkkskClk+YC+Cfaag++C e+C+C++C Nk e+
  evm_27.model.AmTr_v1.0_scaffold00002.637 577 CKRCNCKKSKCLKLYCDCFAAGVYCIESCSCKECLNKPEN 616
                                               89**********************************9875 PP

2TCR50.73.5e-16661699139
                                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                                               ++k+gCnCkks ClkkYCeC++a++ Cs+ C+C +CkN+
  evm_27.model.AmTr_v1.0_scaffold00002.637 661 RHKRGCNCKKSMCLKKYCECYQARVGCSDGCRCVGCKNT 699
                                               589***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-14575616IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.923576701IPR005172CRC domain
PfamPF036384.1E-11578613IPR005172CRC domain
SMARTSM011142.1E-18661702IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.6E-12663699IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 897 aa     Download sequence    Send to blast
MDTPEKCRDL EASASVEGSP LFTFLCNLSP IKPVRSVHSL TLPFPSAVFT SPRISSLTES  60
SLRRHRFSDV TKVERCSINE DGESKREDLG VIDADHSSVT EASREVMCYE VLHASVHENS  120
NTKSSSIFTS CSPSKYVSEY LVNSSEEGID NVDSPDVNSR LTGKLPQNLQ DISLKEMGTS  180
HYNIEAGESN KDATPKPVVQ FLDTSCENPQ ETLREGMDST GMQQQEVKVE KTSVTLLEEK  240
TDDVAQCIWV NSDADPVDDL YVTDAYMGLQ SCIRPDERSM DQKAAGSNLV LLDPQQKTVN  300
EWSNLQSIGP VSCFQHEGHD PAPQFGGSVE LSNLNHTPHL GSNTAQQLPA SSNLSDKTDV  360
RSICPPKHWI PFSLKGGNLH HRGMLRRCLD FEAAVAHRKN IEGNNTGKPA SGPPESESQA  420
LTPDNSNLNI SDSTHSASVL ASDDKQLLPS KAELSLQRPS SVTVMPSGIG LHLNSLTSKS  480
ESSKMEKVKQ ETLVPSSWPI TTASSAGPFH SMKIGPRFLS TTLPVKQSER ELERANKSLA  540
VQDGPQAPGT DLGEEFNQSS PRKRRKRLSS SLDGEGCKRC NCKKSKCLKL YCDCFAAGVY  600
CIESCSCKEC LNKPENVDVV LETRQQIESR NPLAFAPKIV KVVEAAPDPG DEANKTPASA  660
RHKRGCNCKK SMCLKKYCEC YQARVGCSDG CRCVGCKNTF GVKEGSESLV NRGSEGEVEE  720
TESCENDGGD EKLQLVEFSQ EERQSLENTP PITPSFPYGG LPPNVHFTQE KHLYSSDSRF  780
LALRKLVGSS HISSNAPLTN PEFCQRHQVV CQKSLQKVPE EDDTPEILRG QGSPERSVKS  840
SSPNQKRVSP PQKQFSPSPC LKSGRKLVLR AISTNVAITS HADFSSKLVQ SDAASN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-205556982120Protein lin-54 homolog
5fd3_B2e-205556982120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1560567PRKRRKRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006838992.10.0uncharacterized protein LOC18429646 isoform X2
TrEMBLW1P1W40.0W1P1W4_AMBTC; Uncharacterized protein
STRINGERN015610.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.13e-76Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]