PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00002.627
Common NameAMTR_s00002p00271480, LOC18429636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 637aa    MW: 72074.2 Da    PI: 6.3946
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00002.627genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.61.6e-28101185187
                                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                                               rW+++e+laL+++r+++e  +++++ k+p We+vs+k++e gf+rs+k+Ckek+en++k+ykk++++++
  evm_27.model.AmTr_v1.0_scaffold00002.627 101 RWPREETLALLKIRSSIEAGMGDSNVKGPIWEHVSRKLAELGFNRSAKKCKEKFENVSKYYKKTRDSAN 169
                                               8******************************************************************** PP

                                  trihelix  70 krtsessstcpyfdqlea 87 
                                                r++++  ++++f++lea
  evm_27.model.AmTr_v1.0_scaffold00002.627 170 TRQDGR--SYRFFNELEA 185
                                               985555..5******985 PP

2trihelix100.51.4e-31402486186
                                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                                               rW+++ev +Li++r+++++r++++ +k+ lWe +sk m++ g++rs+k+Ckekwen+nk+++k+k+  k
  evm_27.model.AmTr_v1.0_scaffold00002.627 402 RWPRSEVICLIRLRSNLDQRFNESGSKGSLWENISKGMAQLGYNRSAKRCKEKWENINKYFRKTKDATK 470
                                               8******************************************************************** PP

                                  trihelix  70 krtsessstcpyfdqle 86 
                                               +r +++s+tcpyf+ l 
  evm_27.model.AmTr_v1.0_scaffold00002.627 471 SR-PPDSKTCPYFHLLS 486
                                               *8.99999******875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.01598160IPR001005SANT/Myb domain
CDDcd122033.29E-23100165No hitNo description
PfamPF138374.3E-20100186No hitNo description
PROSITE profilePS500906.539100158IPR017877Myb-like domain
SMARTSM007170.0011399461IPR001005SANT/Myb domain
CDDcd122036.93E-29401466No hitNo description
PROSITE profilePS500907.073402459IPR017877Myb-like domain
PfamPF138371.3E-20402486No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0001158Molecular Functionenhancer sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MQSSVEFNGV SDHIHQLLAA RSAHSLPMNL SPPPFFTIDA QPPDLRIGPG NPQLQNNPSN  60
ELGLFRQLHQ SDPFKDNKNA DGLEEEELMT DNRSICEASN RWPREETLAL LKIRSSIEAG  120
MGDSNVKGPI WEHVSRKLAE LGFNRSAKKC KEKFENVSKY YKKTRDSANT RQDGRSYRFF  180
NELEALYNGG NNQFKPVETL SQQKTTVQKT NGEPNVCLNS HSSEGTSEEE TLENPETHAN  240
PSASDQNRKK RKRKRSSLEL MKGFCESMVE QLMHHQEELQ NRLLEAVEKR DQERIAREGE  300
WKMQEMARLN RETEIRAQEH ALASDREAAI IEFLKKFTEN SAENQSPTQA PDPKPEEAPS  360
SANPTNSLAL PPENHSPNPN PITEEKSDQS GVVNNGGFHL KRWPRSEVIC LIRLRSNLDQ  420
RFNESGSKGS LWENISKGMA QLGYNRSAKR CKEKWENINK YFRKTKDATK SRPPDSKTCP  480
YFHLLSNLYQ KKMELSPTQK PENSSNSTAT LEIERENEVE RESESLRDGV QTVGERPNVL  540
LPSIDAGDDR GAMIMTHDPE TSRNLYDETV MNGKISMERM VKEMIEMPHG HGHSHQCGVP  600
LNMGSLHASD AQEQLSQSAF MALVCKLSSS NYNTDE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1247252RKKRKR
2248253KKRKRK
3248254KKRKRKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00011PBMTransfer from AT5G28300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006838982.10.0trihelix transcription factor GTL1 isoform X1
TrEMBLW1P1V20.0W1P1V2_AMBTC; Uncharacterized protein
STRINGERN015510.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28300.11e-58Trihelix family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]