PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00002.340
Common NameAMTR_s00002p00248800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 217aa    MW: 24467.9 Da    PI: 5.7481
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00002.340genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26090.61.9e-28211192100
                                    DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal.peeeredamsslvyeAeara 69 
                                               C++Ck+++rkC +dC+lapyfpa+++ +f  +h lFG ++++ +l+ + ++ +r+da++s++yeA+ar+
  evm_27.model.AmTr_v1.0_scaffold00002.340  21 CSSCKYQGRKCDPDCILAPYFPADRMDDFLKFHSLFGIERICPILTLMiEPIKRPDAVKSMLYEANARL 89 
                                               ********************************************997769999**************** PP

                                    DUF260  70 rdPvyGavgvilklqqqleqlkaelallkee 100
                                               + P  G++ +i+ lq+ql+ l+ +l++lk+e
  evm_27.model.AmTr_v1.0_scaffold00002.340  90 NHP-GGCMYIIHMLQEQLKMLEYKLHSLKQE 119
                                               ***.6********************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.21119120IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-2921117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGSRQNWCKI MASSNSIRQI CSSCKYQGRK CDPDCILAPY FPADRMDDFL KFHSLFGIER  60
ICPILTLMIE PIKRPDAVKS MLYEANARLN HPGGCMYIIH MLQEQLKMLE YKLHSLKQEP  120
PHWRGVFLGQ LGHGIDNLQR NYSANQELDH GLLEAQQLDH DSFEAQQLEQ QQERVDLQVV  180
HGGTGGVVEG GEVAEVGQHG GVVDTEMMDT QVFLNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-172111912110LOB family transfactor Ramosa2.1
5ly0_B5e-172111912110LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621719.11e-149LOB domain-containing protein 6
TrEMBLW1P0V51e-160W1P0V5_AMBTC; Uncharacterized protein
STRINGERN012641e-161(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.18e-22LOB domain-containing protein 22
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]