PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00002.171
Common NameAMTR_s00002p00191340, LOC18429171
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GATA
Protein Properties Length: 526aa    MW: 58878.1 Da    PI: 6.818
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00002.171genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.94.4e-16741135
                                      GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                                              C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  evm_27.model.AmTr_v1.0_scaffold00002.171  7 CYHCGVTSTPLWRNGPPDKPVLCNACGSRWRTKGT 41
                                              ****************55555***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.3E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-11546No hitNo description
CDDcd002026.37E-16651No hitNo description
PROSITE profilePS5011411.345740IPR000679Zinc finger, GATA-type
PfamPF003206.7E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.8E-12741IPR013088Zinc finger, NHR/GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPDKPVLCN ACGSRWRTKG TLTNYTPLHS RGEAIESDVS  60
NFPKVKNPSL KLKEDKLHKR KQNDIIEEAK GEEAGFALYR RGLEEDTSTR SSSGSAISYS  120
ESCVQFASTD AKDIRGSAQS NAWDSLIPSR KRTCVNRQKP SSVEKLTKEL YCILHEQELS  180
YLSGTSEEDL LFETTTPMVS VEIGHGGVLI RPPNSLAQEE ESEASSLLTE SKAHFLNDDC  240
SRSTSHHVNI PSKGCNFSEV GDGIVKTNIG EPIQEDSQRN KTSDDECDIL WSSNSPLISI  300
DLKDVINFEE FTRHLVHEEK LTSYLTSVDT NQLPESLKRM FDSHQFQETL SSFQQLLSEG  360
IFDNSFSGEN IWEFKILKKL VLNDMVKARW VEQYKLHKVP KGKQIRREKG VPSAFRFPDC  420
HDAVELKTNH DGPCRQKFPK PKSLMKLPKR LPRNGSITLP SIKSQPANSN DISDKASCYN  480
KEQTPNYGHC FSPKSLFATS SPDRNSMLDA MHGLVDDPEL MLGFP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006838526.10.0GATA transcription factor 26
TrEMBLW1P2B30.0W1P2B3_AMBTC; Uncharacterized protein
STRINGERN010950.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27491530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-112GATA transcription factor 26
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]