PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00001.416
Common NameAMTR_s00001p00267560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 461aa    MW: 51014 Da    PI: 8.3899
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00001.416genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix31.93.4e-101852511582
                                  trihelix  15 remeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyf 82 
                                               +e+  ++ r+k ++ + ++v+++++++g++r +k+   kw+n+ ++++k+ e+ek++++e++   +yf
  evm_27.model.AmTr_v1.0_scaffold00001.416 185 SEVSGSSARAKTRAEKDKQVAEFLSRHGVNRDAKTSGTKWDNMLGEFRKVYEWEKGGENEKV-GKSYF 251
                                               37888888999*********************************************987776.44455 PP

Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MGDKGDMMKQ SSSFKEPQPQ EELHHQYQLQ RHQKQQHREF CVPVPPASAN IPSPYTPKTL  60
AHREEAERCE PSPKRPRYPV HQWKLIPATM AAPASTQQQV VGYSTSGSSP QAHVSAVAGS  120
SSPAPSSPSS SPRPSFSAGS GQDQAKPTQF LQIRKGKFVS PVWKPNEMLW LARAWRQQYC  180
GGDTSEVSGS SARAKTRAEK DKQVAEFLSR HGVNRDAKTS GTKWDNMLGE FRKVYEWEKG  240
GENEKVGKSY FRLSPYERKM HRLPASFDED VFEEMAQFMA ARGRGLPACK ASTGEGGGAR  300
DQQLLRPTEM VRNSDEGESP VSKQRAILAR NQTGLIAGTT QSSAMEEAGC REMRRVGKMR  360
MLWEESVTLW AEEGEQEGRG RIKMDNLGFL NVNQLTFFDD TMAANSMEGL DDGPLSGFSA  420
DTFACDQQLR VFGRRNSSAG HSEAAQPQPS LAEPCMRCES *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011629107.10.0uncharacterized protein LOC18424474
TrEMBLW1NMM50.0W1NMM5_AMBTC; Uncharacterized protein
STRINGERM965390.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP947967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.15e-08Trihelix family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]