PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00001.321
Common NameAMTR_s00001p00251940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 550aa    MW: 61948.7 Da    PI: 5.7574
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00001.321genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.62.2e-30318402186
                                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                                               rW++ ev+aLi++r+++e ++r+   k++lWe+vs+ m+  g++rs+k+Ckekwen+nk+++k+k +++
  evm_27.model.AmTr_v1.0_scaffold00001.321 318 RWPRAEVQALIRVRTRLEFKFREPGGKGALWEDVSATMAGLGYSRSAKRCKEKWENINKYFRKTKGNAR 386
                                               8******************************************************************** PP

                                  trihelix  70 krtsessstcpyfdqle 86 
                                               kr + +s+tcpyf+ql+
  evm_27.model.AmTr_v1.0_scaffold00001.321 387 KR-PLHSKTCPYFHQLD 402
                                               97.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.26E-25317382No hitNo description
PfamPF138372.2E-20317403No hitNo description
PROSITE profilePS500906.957318375IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MQSGYGVPEM QQFMVDGCSL FSIAPTHDQH PLNPKQQQQQ QRFSSHLQFF HHQQQQQLVV  60
DPNPSGAAHA SDRCSVIDIR GPYHIIHSNN GCRKLGDPTY SRNPTTASKE DISTPKFFEK  120
KLSEAPDSKT TTTTITSYRL FGELEAIYTG SSLPRNSALD LQTASSSALT NDNHTIPPEG  180
HAFQASEKRP SEAEVIPVSK TLPRRNKKNK ELVSALSTFF ERLVRQVMEH QEILHAKFVE  240
VLEKRDRERQ ELEDAWRSRE AERLGQEAAA RTRERTLASV REAAILSFLE KLTGQAPTVP  300
LADGSGGGGG TEMTLSRRWP RAEVQALIRV RTRLEFKFRE PGGKGALWED VSATMAGLGY  360
SRSAKRCKEK WENINKYFRK TKGNARKRPL HSKTCPYFHQ LDMLYGKVKG KGGRERHDEE  420
EDRGSDLLEA MVRPDLTLST HEGKYKGLRL DNFRSDGMDI AESPSKQKTT TVEEDEENPE  480
DEDDDDDYDD GDENNEEEDE EEGEKEMRYE KRLECVGEGE EKGHSLMDLV HKLAGSTSTG  540
AMADDFSGL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011628987.10.0trihelix transcription factor GT-2
TrEMBLW1NMD20.0W1NMD2_AMBTC; Uncharacterized protein
STRINGERM964440.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-48Trihelix family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]