PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G67411.1
Common NameK8K14, SCL16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 202aa    MW: 23286.7 Da    PI: 4.9338
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G67411.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS136.23.4e-421200123312
         GRAS 123 lQWpaLlqaLasRp..egppslRiTgvgspesg.....skeeleetgerLakfAeelgvpfefnvl...vakrledleleeLrvkp...gEalaVnlv 207
                  +Q p+L++++a++   ++pp l++T+++s +++        ++ee+g++L +fA++ +v +ef+++   +++ l++l +e+Lr++p   +Eal+Vn++
  AT5G67411.1   1 MQIPTLIDSMANKLhkKPPPLLKLTVIASDAEFhppplLGISYEELGSKLVNFATTRNVAMEFRIIsssYSDGLSSL-IEQLRIDPfvfNEALVVNCH 97 
                  7**********988778899*********88889988888999**********************966555566666.9******************* PP

         GRAS 208 lqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaer 305
                  ++lh+++de ++++  r+ +Lk +++l+P++v+++++++d +s++F  r+ +  +y++  +d+ e+ l r se+r+++E+  ++++i nvva+egaer
  AT5G67411.1  98 MMLHYIPDEILTSNL-RSVFLKELRDLNPTIVTLIDEDSDFTSTNFISRLRSLYNYMWIPYDTAEMFLTRGSEQRQWYEAD-ISWKIDNVVAKEGAER 193
                  *******88777776.*****************************************************************.**************** PP

         GRAS 306 rerhetl 312
                  +er e +
  AT5G67411.1 194 VERLEPK 200
                  ***9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035141.2E-391200IPR005202Transcription factor GRAS
PROSITE profilePS5098522.5261202IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003674Molecular Functionmolecular_function
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MQIPTLIDSM ANKLHKKPPP LLKLTVIASD AEFHPPPLLG ISYEELGSKL VNFATTRNVA  60
MEFRIISSSY SDGLSSLIEQ LRIDPFVFNE ALVVNCHMML HYIPDEILTS NLRSVFLKEL  120
RDLNPTIVTL IDEDSDFTST NFISRLRSLY NYMWIPYDTA EMFLTRGSEQ RQWYEADISW  180
KIDNVVAKEG AERVERLEPK SR
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G67411
AtGenExpressAT5G67411
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G67411.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G67411
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4876220.0DQ487622.1 Arabidopsis thaliana clone 0000003524_0000003052 unknown protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001032167.11e-148GRAS family transcription factor
SwissprotQ2V2T91e-150SCL16_ARATH; Putative scarecrow-like protein 16
TrEMBLD7MUQ81e-128D7MUQ8_ARALL; Putative uncharacterized protein
STRINGAT5G67411.11e-148(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Publications ? help Back to Top
  1. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  2. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  3. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]