PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G66940.1
Common NameDOF5.8, K8A10.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 225aa    MW: 24117.6 Da    PI: 9.325
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G66940.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.4e-372888262
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 ++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGg +rk+ k+s
  AT5G66940.1 28 QQEQLSCPRCESTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGVSRKSSKRS 88
                 57899***************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-40276IPR003851Zinc finger, Dof-type
PfamPF027016.2E-333086IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4073286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MPSEFSESRR VPKIPHGQGG SVAIPTDQQE QLSCPRCEST NTKFCYYNNY NFSQPRHFCK  60
SCRRYWTHGG TLRDIPVGGV SRKSSKRSRT YSSAATTSVV GSRNFPLQAT PVLFPQSSSN  120
GGITTAKGSA SSFYGGFSSL INYNAAVSRN GPGGGFNGPD AFGLGLGHGS YYEDVRYGQG  180
ITVWPFSSGA TDAATTTSHI AQIPATWQFE GQESKVGFVS GDYVA
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184251320.0
Genevisible247066_at0.0
Expression AtlasAT5G66940-
AtGenExpressAT5G66940-
ATTED-IIAT5G66940-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. In this study, it is shown that MONOPTEROS (MP) directly activates the Dof5.8 promoter. Phenotypic analysis with the mp dof5.8 double mutants revealed that mutations within Dof5.8 enhanced the phenotype of a weak allele of mp.
    [PMID: 25336688]
  2. under abiotic stress conditions, ATDOF5.8 regulates the expression of ANAC069, and the activated ANAC069 binds to NAC recognition sequences or other motifs to regulate the expression of genes containing these motifs in their promoters. [ATDOF5.8]
    [PMID: 25572919]
  3. The overexpression of Dof5.8 modulates the auxin response and leads to impaired vein formation in A. thaliana.[Dof5.8]
    [PMID: 25794540]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G66940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G66940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266400.0AB026640.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8A10.
GenBankBT0295230.0BT029523.1 Arabidopsis thaliana At5g66940 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201495.11e-166Dof-type zinc finger DNA-binding family protein
SwissprotQ9FGD61e-167DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLC0SVW41e-164C0SVW4_ARATH; Uncharacterized protein At5g66940 (Fragment)
STRINGAT5G66940.11e-165(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  6. Konishi M,Donner TJ,Scarpella E,Yanagisawa S
    MONOPTEROS directly activates the auxin-inducible promoter of the Dof5.8 transcription factor gene in Arabidopsis thaliana leaf provascular cells.
    J. Exp. Bot., 2015. 66(1): p. 283-91
    [PMID:25336688]
  7. He L,Su C,Wang Y,Wei Z
    ATDOF5.8 protein is the upstream regulator of ANAC069 and is responsive to abiotic stress.
    Biochimie, 2015. 110: p. 17-24
    [PMID:25572919]
  8. Konishi M,Yanagisawa S
    Transcriptional repression caused by Dof5.8 is involved in proper vein network formation in Arabidopsis thaliana leaves.
    J. Plant Res., 2015. 128(4): p. 643-52
    [PMID:25794540]