PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G66320.2
Common NameGATA5, K1L20.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 339aa    MW: 37091.1 Da    PI: 5.8959
Description GATA transcription factor 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G66320.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18251285135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  AT5G66320.2 251 CSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRL 285
                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.3E-1131339IPR016679Transcription factor, GATA, plant
SuperFamilySSF577165.7E-14244307No hitNo description
SMARTSM004011.6E-15245299IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.793245281IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.5E-15249283IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.31E-14250298No hitNo description
PROSITE patternPS003440251276IPR000679Zinc finger, GATA-type
PfamPF003201.4E-16251285IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEQAALKSSV RKEMALKTTS PVYEEFLAVT TAQNGFSVDD FSVDDLLDLS NDDVFADEET  60
DLKAQHEMVR VSSEEPNDDG DALRRSSDFS GCDDFGSLPT SELSLPADDL ANLEWLSHFV  120
EDSFTEYSGP NLTGTPTEKP AWLTGDRKHP VTAVTEETCF KSPVPAKARS KRNRNGLKVW  180
SLGSSSSSGP SSSGSTSSSS SGPSSPWFSG AELLEPVVTS ERPPFPKKHK KRSAESVFSG  240
ELQQLQPQRK CSHCGVQKTP QWRAGPMGAK TLCNACGVRY KSGRLLPEYR PACSPTFSSE  300
LHSNHHRKVI EMRRKKEPTS DNETGLNQLV QSPQAVPSF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.281700.0floral meristem| flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247086_at0.0
Expression AtlasAT5G66320-
AtGenExpressAT5G66320-
ATTED-IIAT5G66320-
Functional Description ? help Back to Top
Source Description
TAIREncodes GATA transcription factor gene GNC, involved in regulating carbon and nitrogen metabolism. Expression occurs in aerial tissue at an early stage of development and is inducible by nitrate.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G66320.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G66320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0103670.0BT010367.1 Arabidopsis thaliana At5g66320 mRNA, complete cds.
GenBankAY1364500.0AY136450.1 Arabidopsis thaliana GATA-binding transcription factor-like protein (At5g66320) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201433.10.0GATA transcription factor 5
RefseqNP_975002.10.0GATA transcription factor 5
SwissprotQ9FH570.0GATA5_ARATH; GATA transcription factor 5
TrEMBLD7MMY80.0D7MMY8_ARALL; Zinc finger family protein
STRINGAT5G66320.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  5. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  6. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  7. Liu PP,Koizuka N,Martin RC,Nonogaki H
    The BME3 (Blue Micropylar End 3) GATA zinc finger transcription factor is a positive regulator of Arabidopsis seed germination.
    Plant J., 2005. 44(6): p. 960-71
    [PMID:16359389]
  8. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]