PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G66300.1
Common NameANAC105, K1L20.8, NAC105, VND3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 292aa    MW: 34320.5 Da    PI: 6.4071
Description NAC domain containing protein 105
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G66300.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.5e-54131392127
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  ppGfrFhPtdeelv +yLkkk+++++++l +vi+e+d+yk+ePwdL++  ++   e++ewyfFs+rdkky+tg+r+nrat +g+Wkatg+dk+v+  +
  AT5G66300.1  13 PPGFRFHPTDEELVGYYLKKKIASQRIDL-DVIREIDLYKIEPWDLQErcRIGYeEQTEWYFFSHRDKKYPTGTRTNRATVAGFWKATGRDKAVYL-N 108
                  9****************************.9***************953433332667**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyr 127
                  ++l+g++ktLvfy+grap+g+k+dW++hey 
  AT5G66300.1 109 SKLIGMRKTLVFYRGRAPNGQKSDWIIHEYY 139
                  99***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-5810162IPR003441NAC domain
PROSITE profilePS5100557.38812162IPR003441NAC domain
PfamPF023651.1E-2613138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0071555Biological Processcell wall organization
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000039anatomyshoot axis vascular system
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025275anatomyprocambium
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MMKVDQDYSC SIPPGFRFHP TDEELVGYYL KKKIASQRID LDVIREIDLY KIEPWDLQER  60
CRIGYEEQTE WYFFSHRDKK YPTGTRTNRA TVAGFWKATG RDKAVYLNSK LIGMRKTLVF  120
YRGRAPNGQK SDWIIHEYYS LESHQNSPPQ EEGWVVCRAF KKRTTIPTKR RQLWDPNCLF  180
YDDATLLEPL DKRARHNPDF TATPFKQELL SEASHVQDGD FGSMYLQCID DDQFSQLPQL  240
ESPSLPSEIT PHSTTFSENS SRKDDMSSEK RITDWRYLDK FVASQFLMSG ED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-5051648170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247084_at0.0
Expression AtlasAT5G66300-
AtGenExpressAT5G66300-
ATTED-IIAT5G66300-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Detected in root protoxylem and metaxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Present in developing xylems (PubMed:16103214, PubMed:17565617). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC-domain transcription factor. Expressed in the vascular tissue.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00590DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G66300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FH59
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Reduced secondary wall thickening in vessels and collapsed vessel. {ECO:0000269|PubMed:25148240}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G66300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0202160.0BT020216.1 Arabidopsis thaliana At5g66300 mRNA, complete cds.
GenBankBT0158240.0BT015824.1 Arabidopsis thaliana At5g66300 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201431.10.0NAC domain containing protein
SwissprotQ9FH590.0NC105_ARATH; NAC domain-containing protein 105
TrEMBLD7MMZ10.0D7MMZ1_ARALL; Putative uncharacterized protein
STRINGAT5G66300.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151341619
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kubo M, et al.
    Transcription switches for protoxylem and metaxylem vessel formation.
    Genes Dev., 2005. 19(16): p. 1855-60
    [PMID:16103214]
  4. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  5. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  6. Yamaguchi M,Kubo M,Fukuda H,Demura T
    Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots.
    Plant J., 2008. 55(4): p. 652-64
    [PMID:18445131]
  7. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  8. Zhou J,Zhong R,Ye ZH
    Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.
    PLoS ONE, 2014. 9(8): p. e105726
    [PMID:25148240]