PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G65590.1
Common NameDOF5.7, K21L13.10, SCAP1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 316aa    MW: 34853.8 Da    PI: 9.0422
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G65590.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-383796261
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                  +++lkcprC+s ntkfCyynnyslsqPr+fCk+CrryWt+GGalrnvP+Ggg+rk kks
  AT5G65590.1 37 DQQNLKCPRCNSPNTKFCYYNNYSLSQPRHFCKSCRRYWTRGGALRNVPIGGGCRKTKKS 96
                 57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-372495IPR003851Zinc finger, Dof-type
PfamPF027011.3E-323995IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4324195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MSSHTNLPSP KPVPKPDHRI SGTSQTKKPP SSSVAQDQQN LKCPRCNSPN TKFCYYNNYS  60
LSQPRHFCKS CRRYWTRGGA LRNVPIGGGC RKTKKSIKPN SSMNTLPSSS SSQRFFSSIM  120
EDSSKFFPPP TTMDFQLAGL SLNKMNDLQL LNNQEVLDLR PMMSSGRENT PVDVGSGLSL  180
MGFGDFNNNH SPTGFTTAGA SDGNLASSIE TLSCLNQDLH WRLQQQRMAM LFGNSKEETV  240
VVERPQPILY RNLEIVNSSS PSSPTKKGDN QTEWYFGNNS DNEGVISNNA NTGGGGSEWN  300
NGIQAWTDLN HYNALP
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247144_at0.0
Expression AtlasAT5G65590-
AtGenExpressAT5G65590-
ATTED-IIAT5G65590-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. This study isolated an Arabidopsis mutant, stomatal carpenter 1 (scap1), that develops irregularly shaped guard cells and lacks the ability to control stomatal aperture, including CO2-induced stomatal closing and light-induced stomatal opening.
    [PMID: 23453954]
  2. SCAP1 plays roles in guard cells differentiation and stomatal development.
    [PMID: 27484174]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G65590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G65590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266390.0AB026639.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K21L13.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201362.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ9LSL60.0DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A384KZI00.0A0A384KZI0_ARATH; SCAP1
TrEMBLC0SVW20.0C0SVW2_ARATH; Uncharacterized protein At5g65590 (Fragment)
STRINGAT5G65590.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  6. Negi J, et al.
    A Dof transcription factor, SCAP1, is essential for the development of functional stomata in Arabidopsis.
    Curr. Biol., 2013. 23(6): p. 479-84
    [PMID:23453954]
  7. Castorina G,Fox S,Tonelli C,Galbiati M,Conti L
    A novel role for STOMATAL CARPENTER 1 in stomata patterning.
    BMC Plant Biol., 2016. 16(1): p. 172
    [PMID:27484174]