PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G65210.5
Common NameBZIP47, MQN23.15, TGA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 368aa    MW: 42063.6 Da    PI: 7.7595
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G65210.5genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-1182118339
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                  ++k +rr+++NReAAr+sR+RKka++++Le+   +L 
  AT5G65210.5  82 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLI 118
                  6899**************************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-680143IPR004827Basic-leucine zipper domain
PfamPF001702.1E-882113IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.77282124IPR004827Basic-leucine zipper domain
CDDcd147083.12E-2284135No hitNo description
SuperFamilySSF579592.56E-784119No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-786112No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
PfamPF141445.1E-30170245IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0005516Molecular Functioncalmodulin binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MNSTSTHFVP PRRVGIYEPV HQFGMWGESF KSNISNGTMN TPNHIIIPNN QKLDNNVSED  60
TSHGTAGTPH MFDQEASTSR HPDKIQRRLA QNREAARKSR LRKKAYVQQL ETSRLKLIQL  120
EQELDRARQQ GFYVGNGIDT NSLGFSETMN PGIAAFEMEY GHWVEEQNRQ ICELRTVLHG  180
HINDIELRSL VENAMKHYFE LFRMKSSAAK ADVFFVMSGM WRTSAERFFL WIGGFRPSDL  240
LKVLLPHFDV LTDQQLLDVC NLKQSCQQAE DALTQGMEKL QHTLADCVAA GQLGEGSYIP  300
QVNSAMDRLE ALVSFVNQAD HLRHETLQQM YRILTTRQAA RGLLALGEYF QRLRALSSSW  360
ATRHREPT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.208180.0leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247199_at0.0
Expression AtlasAT5G65210-
AtGenExpressAT5G65210-
ATTED-IIAT5G65210-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:8628224}.
Functional Description ? help Back to Top
Source Description
TAIREncodes TGA1, a redox-controlled regulator of systemic acquired resistance. TGA1 targets the activation sequence-1 (as-1) element of the promoter region of defense proteins. TGA1 are S-nitrosylated.
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Function -- GeneRIF ? help Back to Top
  1. S-nitrosoglutathione enhances the DNA binding activity of TGA1 in presence of NPR1 and that both proteins, NPR1 and TGA1, are S-nitrosylated after treatment with the NO donor.
    [PMID: 20716698]
  2. clade I TGA factors as positive regulators of one or more ER-related secretion pathways
    [PMID: 24086773]
  3. TGA1 and TGA4 as important regulatory factors of the nitrate response in Arabidopsis roots.
    [PMID: 25039575]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00586DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G65210.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G65210
IntActSearch Q39237
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G65210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1288380.0AY128838.1 Arabidopsis thaliana DNA binding protein TGA1a-like protein (At5g65210) mRNA, complete cds.
GenBankAY0995930.0AY099593.1 Arabidopsis thaliana DNA binding protein TGA1a-like protein (At5g65210) mRNA, complete cds.
GenBankAY0870490.0AY087049.1 Arabidopsis thaliana clone 31032 mRNA, complete sequence.
GenBankAK3174880.0AK317488.1 Arabidopsis thaliana AT5G65210 mRNA, complete cds, clone: RAFL23-11-L19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001032147.10.0transcription factor TGA1
RefseqNP_001032148.10.0transcription factor TGA1
RefseqNP_001032149.10.0transcription factor TGA1
RefseqNP_201324.10.0transcription factor TGA1
RefseqNP_851273.10.0transcription factor TGA1
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLB9DGG10.0B9DGG1_ARATH; AT5G65210 protein
STRINGAT5G65210.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Zhou JM, et al.
    NPR1 differentially interacts with members of the TGA/OBF family of transcription factors that bind an element of the PR-1 gene required for induction by salicylic acid.
    Mol. Plant Microbe Interact., 2000. 13(2): p. 191-202
    [PMID:10659709]
  2. Després C,DeLong C,Glaze S,Liu E,Fobert PR
    The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors.
    Plant Cell, 2000. 12(2): p. 279-90
    [PMID:10662863]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Weigel RR,Bäuscher C,Pfitzner AJ,Pfitzner UM
    NIMIN-1, NIMIN-2 and NIMIN-3, members of a novel family of proteins from Arabidopsis that interact with NPR1/NIM1, a key regulator of systemic acquired resistance in plants.
    Plant Mol. Biol., 2001. 46(2): p. 143-60
    [PMID:11442055]
  5. Reddy VS,Ali GS,Reddy AS
    Genes encoding calmodulin-binding proteins in the Arabidopsis genome.
    J. Biol. Chem., 2002. 277(12): p. 9840-52
    [PMID:11782485]
  6. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  7. Després C, et al.
    The Arabidopsis NPR1 disease resistance protein is a novel cofactor that confers redox regulation of DNA binding activity to the basic domain/leucine zipper transcription factor TGA1.
    Plant Cell, 2003. 15(9): p. 2181-91
    [PMID:12953119]
  8. Schindler U,Beckmann H,Cashmore AR
    TGA1 and G-box binding factors: two distinct classes of Arabidopsis leucine zipper proteins compete for the G-box-like element TGACGTGG.
    Plant Cell, 1992. 4(10): p. 1309-19
    [PMID:1446171]
  9. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  10. Zhang Y, et al.
    Negative regulation of defense responses in Arabidopsis by two NPR1 paralogs.
    Plant J., 2006. 48(5): p. 647-56
    [PMID:17076807]
  11. Kesarwani M,Yoo J,Dong X
    Genetic interactions of TGA transcription factors in the regulation of pathogenesis-related genes and disease resistance in Arabidopsis.
    Plant Physiol., 2007. 144(1): p. 336-46
    [PMID:17369431]
  12. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  13. Li S, et al.
    Nuclear activity of ROXY1, a glutaredoxin interacting with TGA factors, is required for petal development in Arabidopsis thaliana.
    Plant Cell, 2009. 21(2): p. 429-41
    [PMID:19218396]
  14. Lindermayr C,Sell S,M
    Redox regulation of the NPR1-TGA1 system of Arabidopsis thaliana by nitric oxide.
    Plant Cell, 2010. 22(8): p. 2894-907
    [PMID:20716698]
  15. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  16. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  17. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  18. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  19. Shearer HL, et al.
    Arabidopsis clade I TGA transcription factors regulate plant defenses in an NPR1-independent fashion.
    Mol. Plant Microbe Interact., 2012. 25(11): p. 1459-68
    [PMID:22876961]
  20. Wang L,Fobert PR
    Arabidopsis clade I TGA factors regulate apoplastic defences against the bacterial pathogen Pseudomonas syringae through endoplasmic reticulum-based processes.
    PLoS ONE, 2013. 8(9): p. e77378
    [PMID:24086773]
  21. Alvarez JM, et al.
    Systems approach identifies TGA1 and TGA4 transcription factors as important regulatory components of the nitrate response of Arabidopsis thaliana roots.
    Plant J., 2014. 80(1): p. 1-13
    [PMID:25039575]
  22. Lam E,Lam YK
    Binding site requirements and differential representation of TGF factors in nuclear ASF-1 activity.
    Nucleic Acids Res., 1995. 23(18): p. 3778-85
    [PMID:7479010]
  23. de Pater S,Pham K,Memelink J,Kijne J
    Binding specificity and tissue-specific expression pattern of the Arabidopsis bZIP transcription factor TGA2.
    Mol. Gen. Genet., 1996. 250(2): p. 237-9
    [PMID:8628224]