PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G64810.1
Common NameATWRKY51, MXK3.3, WRKY51
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 194aa    MW: 22044 Da    PI: 5.3396
Description WRKY DNA-binding protein 51
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G64810.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY88.17.7e-28109167159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +dDg++WrKYG+K+vk++ + r+YY+C+s+gC+vkk+ver+ +d  +v++tYeg Hnhe
  AT5G64810.1 109 MDDGFKWRKYGKKSVKNNINKRNYYKCSSEGCSVKKRVERDGDDAAYVITTYEGVHNHE 167
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-3096168IPR003657WRKY domain
SuperFamilySSF1182907.98E-26101167IPR003657WRKY domain
PROSITE profilePS5081127.393104169IPR003657WRKY domain
SMARTSM007741.8E-31109168IPR003657WRKY domain
PfamPF031062.8E-22110167IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MNISQNPSPN FTYFSDENFI NPFMDNNDFS NLMFFDIDEG GNNGLIEEEI SSPTSIVSSE  60
TFTGESGGSG SATTLSKKES TNRGSKESDQ TKETGHRVAF RTRSKIDVMD DGFKWRKYGK  120
KSVKNNINKR NYYKCSSEGC SVKKRVERDG DDAAYVITTY EGVHNHESLS NVYYNEMVLS  180
YDHDNWNQHS LLRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2399167775Probable WRKY transcription factor 4
2lex_A2e-2399167775Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.265970.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865327510.0
Expression AtlasAT5G64810-
AtGenExpressAT5G64810-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}.
Function -- GeneRIF ? help Back to Top
  1. WRKY50 and WRKY51 proteins mediate both salicylic acid- and low-18:1-dependent repression of jasmonic acid signaling.
    [PMID: 21030507]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G64810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:21030507}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G64810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0257550.0BT025755.1 Arabidopsis thaliana At5g64810 mRNA, complete cds.
GenBankAF4262520.0AF426252.1 Arabidopsis thaliana WRKY transcription factor 51 (WRKY51) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568995.21e-143putative WRKY transcription factor 51
SwissprotQ93WU91e-145WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLQ1ECH91e-143Q1ECH9_ARATH; At5g64810
STRINGAT5G64810.11e-142(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57112747
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Thibaud-Nissen F, et al.
    Development of Arabidopsis whole-genome microarrays and their application to the discovery of binding sites for the TGA2 transcription factor in salicylic acid-treated plants.
    Plant J., 2006. 47(1): p. 152-62
    [PMID:16824183]
  4. Gao QM,Venugopal S,Navarre D,Kachroo A
    Low oleic acid-derived repression of jasmonic acid-inducible defense responses requires the WRKY50 and WRKY51 proteins.
    Plant Physiol., 2011. 155(1): p. 464-76
    [PMID:21030507]
  5. Cheng Y, et al.
    Structural and functional analysis of VQ motif-containing proteins in Arabidopsis as interacting proteins of WRKY transcription factors.
    Plant Physiol., 2012. 159(2): p. 810-25
    [PMID:22535423]