PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G64060.1
Common Nameanac103, NAC103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 356aa    MW: 39867.6 Da    PI: 4.8801
Description NAC domain containing protein 103
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G64060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.23.5e-4561341129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtd elv +yLk+kv gkk+++ ++i+evdiyk+eP dLp k ++ +++ +wyfF++r+kky++g ++nr+t+ gyWk+tg+d++v   +
  AT5G64060.1   6 LAPGFRFHPTDVELVRYYLKRKVMGKKFQV-DAIAEVDIYKFEPPDLPdKsCLGTGDLKWYFFCPREKKYPKGGKANRSTECGYWKTTGRDRDVSY-N 101
                  579***************************.99**************96447777888*************************************9.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                  +e++g  +tL+++ g+ p+g +tdWv+heyrle
  AT5G64060.1 102 DEVTGKIRTLIYHYGKIPRGDRTDWVIHEYRLE 134
                  999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-533156IPR003441NAC domain
PROSITE profilePS5100551.1956156IPR003441NAC domain
PfamPF023652.4E-248133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGKTNLAPGF RFHPTDVELV RYYLKRKVMG KKFQVDAIAE VDIYKFEPPD LPDKSCLGTG  60
DLKWYFFCPR EKKYPKGGKA NRSTECGYWK TTGRDRDVSY NDEVTGKIRT LIYHYGKIPR  120
GDRTDWVIHE YRLEDKVLAQ KNVPQDTYVL CVLFKKNGLG PRHGSQYGAP FKEEDWSDKE  180
EEYTQNHLVA GPSKETSLAA KASHSYAPKD GLTGVISESC VSDVPPLTAT VLPPLTSDVI  240
AYNPFSSSPL LEVPQVSLDG GELNSMLDLF SVDNDDCLLF DDFDYHNEVR HPDGFVNKEA  300
PVFLGDGNFS GMFDLSNDQV VELQDLIQSP TPHPPSPPAQ ASIPDDSRSN GQTKDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-44215711169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247317_at0.0
Expression AtlasAT5G64060-
AtGenExpressAT5G64060-
ATTED-IIAT5G64060-
Function -- GeneRIF ? help Back to Top
  1. NAC103 expression is highly induced by ER stress and is dependent on bZIP60
    [PMID: 23869562]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G64060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G64060
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G64060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0155830.0BT015583.1 Arabidopsis thaliana At5g64060 mRNA sequence.
GenBankBT0118220.0BT011822.1 Arabidopsis thaliana At5g49950 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201211.10.0NAC domain containing protein 103
SwissprotQ9FY821e-123NAC82_ARATH; NAC domain-containing protein 82
TrEMBLQ9FMJ10.0Q9FMJ1_ARATH; NAC domain containing protein 103
STRINGAT5G64060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Day IS,Reddy VS,Shad Ali G,Reddy AS
    Analysis of EF-hand-containing proteins in Arabidopsis.
    Genome Biol., 2002. 3(10): p. RESEARCH0056
    [PMID:12372144]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  5. Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB
    ATR and ATM play both distinct and additive roles in response to ionizing radiation.
    Plant J., 2006. 48(6): p. 947-61
    [PMID:17227549]
  6. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  7. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  8. Sun L, et al.
    The plant-specific transcription factor gene NAC103 is induced by bZIP60 through a new cis-regulatory element to modulate the unfolded protein response in Arabidopsis.
    Plant J., 2013. 76(2): p. 274-86
    [PMID:23869562]