PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G63790.1
Common NameANAC102, MBK5.27, NAC102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 312aa    MW: 35998.9 Da    PI: 8.6522
Description NAC domain containing protein 102
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G63790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.38.8e-51501741128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lp+GfrFhPtdeelv++yL+++++++++++  vi+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   +
  AT5G63790.1  50 LPAGFRFHPTDEELVKFYLCRRCASEPINV-PVIAEIDLYKFNPWELPEMALYGEKEWYFFSHRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PK 144
                  799***************************.89***************7666789*************************************98..77 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  + g+kk Lvfy g+apkg kt+W+mheyrl
  AT5G63790.1 145 TLGIKKALVFYAGKAPKGIKTNWIMHEYRL 174
                  8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6042202IPR003441NAC domain
PROSITE profilePS5100558.8150202IPR003441NAC domain
PfamPF023654.5E-2651174IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0009507Cellular Componentchloroplast
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000252anatomyendodermis
PO:0000263anatomynon-hair root epidermal cell
PO:0000293anatomyguard cell
PO:0005708anatomycortex
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020131anatomylateral root cap
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDFALFSSIS IFEINHKDPP IRRFIKTQNR ILSTRKQQGT FPKMKAELNL PAGFRFHPTD  60
EELVKFYLCR RCASEPINVP VIAEIDLYKF NPWELPEMAL YGEKEWYFFS HRDRKYPNGS  120
RPNRAAGTGY WKATGADKPI GKPKTLGIKK ALVFYAGKAP KGIKTNWIMH EYRLANVDRS  180
ASTNKKNNLR LDDWVLCRIY NKKGTMEKYL PAAAEKPTEK MSTSDSRCSS HVISPDVTCS  240
DNWEVESEPK WINLEDALEA FNDDTSMFSS IGLLQNDAFV PQFQYQSSDF VDSFQDPFEQ  300
KPFLNWNFAP QG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-824520810174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.492130.0flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247351_at0.0
Expression AtlasAT5G63790-
AtGenExpressAT5G63790-
ATTED-IIAT5G63790-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root cortex, root caps and sepals. Not detected in imbibed seeds. {ECO:0000269|PubMed:19176720}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the NAC family of transcription factors. ANAC102 appears to have a role in mediating response to low oxygen stress (hypoxia) in germinating seedlings.
UniProtMay be involved in regulation of seed germination under flooding. {ECO:0000269|PubMed:19176720}.
Function -- GeneRIF ? help Back to Top
  1. ANAC102 is an important regulator of seed germination under flooding.
    [PMID: 19176720]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G63790.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By low-oxygen stress. {ECO:0000269|PubMed:19176720}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8H115
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible changes in phenotype. {ECO:0000269|PubMed:19176720}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G63790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0008960.0BT000896.1 Arabidopsis thaliana clone C104908 unknown protein (At5g63790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201184.20.0NAC domain-containing protein 102
SwissprotQ8H1150.0NA102_ARATH; NAC domain-containing protein 102
TrEMBLD7MPS80.0D7MPS8_ARALL; Predicted protein
STRINGAT5G63790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gutierrez RA,Ewing RM,Cherry JM,Green PJ
    Identification of unstable transcripts in Arabidopsis by cDNA microarray analysis: rapid decay is associated with a group of touch- and specific clock-controlled genes.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(17): p. 11513-8
    [PMID:12167669]
  3. Klok EJ, et al.
    Expression profile analysis of the low-oxygen response in Arabidopsis root cultures.
    Plant Cell, 2002. 14(10): p. 2481-94
    [PMID:12368499]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Hegedus D, et al.
    Molecular characterization of Brassica napus NAC domain transcriptional activators induced in response to biotic and abiotic stress.
    Plant Mol. Biol., 2003. 53(3): p. 383-97
    [PMID:14750526]
  6. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  7. Kasukabe Y, et al.
    Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(6): p. 712-22
    [PMID:15215506]
  8. Lu Y,Zhu J,Liu P
    A two-step strategy for detecting differential gene expression in cDNA microarray data.
    Curr. Genet., 2005. 47(2): p. 121-31
    [PMID:15688252]
  9. Baerson SR, et al.
    Detoxification and transcriptome response in Arabidopsis seedlings exposed to the allelochemical benzoxazolin-2(3H)-one.
    J. Biol. Chem., 2005. 280(23): p. 21867-81
    [PMID:15824099]
  10. Devoto A, et al.
    Expression profiling reveals COI1 to be a key regulator of genes involved in wound- and methyl jasmonate-induced secondary metabolism, defence, and hormone interactions.
    Plant Mol. Biol., 2005. 58(4): p. 497-513
    [PMID:16021335]
  11. Delessert C, et al.
    The transcription factor ATAF2 represses the expression of pathogenesis-related genes in Arabidopsis.
    Plant J., 2005. 43(5): p. 745-57
    [PMID:16115070]
  12. Vanderauwera S, et al.
    Genome-wide analysis of hydrogen peroxide-regulated gene expression in Arabidopsis reveals a high light-induced transcriptional cluster involved in anthocyanin biosynthesis.
    Plant Physiol., 2005. 139(2): p. 806-21
    [PMID:16183842]
  13. Nakano T, et al.
    Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana.
    J. Plant Res., 2006. 119(4): p. 407-13
    [PMID:16820983]
  14. Bezhani S, et al.
    Unique, shared, and redundant roles for the Arabidopsis SWI/SNF chromatin remodeling ATPases BRAHMA and SPLAYED.
    Plant Cell, 2007. 19(2): p. 403-16
    [PMID:17293567]
  15. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  16. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  17. Dortay H, et al.
    Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana.
    J. Proteome Res., 2008. 7(9): p. 3649-60
    [PMID:18642946]
  18. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  19. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  20. Christianson JA,Wilson IW,Llewellyn DJ,Dennis ES
    The low-oxygen-induced NAC domain transcription factor ANAC102 affects viability of Arabidopsis seeds following low-oxygen treatment.
    Plant Physiol., 2009. 149(4): p. 1724-38
    [PMID:19176720]
  21. Abdeen A,Schnell J,Miki B
    Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3.
    BMC Genomics, 2010. 11: p. 69
    [PMID:20105335]
  22. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  23. Inz
    A subcellular localization compendium of hydrogen peroxide-induced proteins.
    Plant Cell Environ., 2012. 35(2): p. 308-20
    [PMID:21443605]
  24. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  25. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  26. Mehterov N, et al.
    Oxidative stress provokes distinct transcriptional responses in the stress-tolerant atr7 and stress-sensitive loh2 Arabidopsis thaliana mutants as revealed by multi-parallel quantitative real-time PCR analysis of ROS marker and antioxidant genes.
    Plant Physiol. Biochem., 2012. 59: p. 20-9
    [PMID:22710144]
  27. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]