PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G63090.4
Common NameASL4, LOB, MDC12.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 186aa    MW: 20226.9 Da    PI: 8.2137
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G63090.4genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.18.3e-4511109199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el++++
  AT5G63090.4  11 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRLQKELDAAN 108
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  AT5G63090.4 109 A 109
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.18310111IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-4411108IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009066anatomyanther
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MASSSNSYNS PCAACKFLRR KCMPGCIFAP YFPPEEPHKF ANVHKIFGAS NVTKLLNELL  60
PHQREDAVNS LAYEAEARVR DPVYGCVGAI SYLQRQVHRL QKELDAANAD LAHYGLSTSA  120
AGAPGNVVDL VFQPQPLPSQ QLPPLNPVYR LSGASPVMNQ MPRGTGGSYG TFLPWNNGHD  180
QQGGNM
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G63090
AtGenExpressAT5G63090
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
TAIRInvolved in lateral organ development
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Function -- GeneRIF ? help Back to Top
  1. Arabidopsis lateral organ boundaries negatively regulates brassinosteroid accumulation to limit growth in organ boundaries
    [PMID: 23213252]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G63090.4
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G65620 (A), AT2G37630 (A), AT4G08150 (A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G18400, AT1G65620
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G63090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankBT0257450.0BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds.
GenBankAB4738370.0AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds.
GenBankAB1643050.0AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds.
GenBankAB0082650.0AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12.
GenBankAF4478970.0AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201114.11e-138protein LATERAL ORGAN BOUNDARIES
RefseqNP_851252.11e-138protein LATERAL ORGAN BOUNDARIES
RefseqNP_851253.11e-138protein LATERAL ORGAN BOUNDARIES
RefseqNP_851254.11e-138protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML41e-139LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLR0GRT81e-128R0GRT8_9BRAS; Uncharacterized protein
STRINGAT5G63090.11e-137(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Byrne ME,Simorowski J,Martienssen RA
    ASYMMETRIC LEAVES1 reveals knox gene redundancy in Arabidopsis.
    Development, 2002. 129(8): p. 1957-65
    [PMID:11934861]
  2. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  3. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  4. Lin WC,Shuai B,Springer PS
    The Arabidopsis LATERAL ORGAN BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression of KNOX gene expression and in adaxial-abaxial patterning.
    Plant Cell, 2003. 15(10): p. 2241-52
    [PMID:14508003]
  5. Okushima Y, et al.
    Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: unique and overlapping functions of ARF7 and ARF19.
    Plant Cell, 2005. 17(2): p. 444-63
    [PMID:15659631]
  6. Borghi L,Bureau M,Simon R
    Arabidopsis JAGGED LATERAL ORGANS is expressed in boundaries and coordinates KNOX and PIN activity.
    Plant Cell, 2007. 19(6): p. 1795-808
    [PMID:17557810]
  7. Iwakawa H, et al.
    Expression of the ASYMMETRIC LEAVES2 gene in the adaxial domain of Arabidopsis leaves represses cell proliferation in this domain and is critical for the development of properly expanded leaves.
    Plant J., 2007. 51(2): p. 173-84
    [PMID:17559509]
  8. Ha CM,Jun JH,Nam HG,Fletcher JC
    BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes.
    Plant Cell, 2007. 19(6): p. 1809-25
    [PMID:17601823]
  9. Husbands A,Bell EM,Shuai B,Smith HM,Springer PS
    LATERAL ORGAN BOUNDARIES defines a new family of DNA-binding transcription factors and can interact with specific bHLH proteins.
    Nucleic Acids Res., 2007. 35(19): p. 6663-71
    [PMID:17913740]
  10. Hochholdinger F,Zimmermann R
    Conserved and diverse mechanisms in root development.
    Curr. Opin. Plant Biol., 2008. 11(1): p. 70-4
    [PMID:18006363]
  11. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  12. Mangeon A,Bell EM,Lin WC,Jablonska B,Springer PS
    Misregulation of the LOB domain gene DDA1 suggests possible functions in auxin signalling and photomorphogenesis.
    J. Exp. Bot., 2011. 62(1): p. 221-33
    [PMID:20797997]
  13. Yordanov YS,Regan S,Busov V
    Members of the LATERAL ORGAN BOUNDARIES DOMAIN transcription factor family are involved in the regulation of secondary growth in Populus.
    Plant Cell, 2010. 22(11): p. 3662-77
    [PMID:21097711]
  14. Cho E,Zambryski PC
    Organ boundary1 defines a gene expressed at the junction between the shoot apical meristem and lateral organs.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(5): p. 2154-9
    [PMID:21245300]
  15. Uberti-Manassero NG,Lucero LE,Viola IL,Vegetti AC,Gonzalez DH
    The class I protein AtTCP15 modulates plant development through a pathway that overlaps with the one affected by CIN-like TCP proteins.
    J. Exp. Bot., 2012. 63(2): p. 809-23
    [PMID:22016421]
  16. Feng Z,Zhu J,Du X,Cui X
    Effects of three auxin-inducible LBD members on lateral root formation in Arabidopsis thaliana.
    Planta, 2012. 236(4): p. 1227-37
    [PMID:22699776]
  17. M
    Role of a respiratory burst oxidase of Lepidium sativum (cress) seedlings in root development and auxin signalling.
    J. Exp. Bot., 2012. 63(18): p. 6325-34
    [PMID:23095998]
  18. Bell EM, et al.
    Arabidopsis lateral organ boundaries negatively regulates brassinosteroid accumulation to limit growth in organ boundaries.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(51): p. 21146-51
    [PMID:23213252]
  19. Kim J,Lee HW
    Direct activation of EXPANSIN14 by LBD18 in the gene regulatory network of lateral root formation in Arabidopsis.
    Plant Signal Behav, 2013. 8(2): p. e22979
    [PMID:23299420]
  20. Sun X,Feng Z,Meng L,Zhu J,Geitmann A
    Arabidopsis ASL11/LBD15 is involved in shoot apical meristem development and regulates WUS expression.
    Planta, 2013. 237(5): p. 1367-78
    [PMID:23397191]
  21. Wang X,Zhang S,Su L,Liu X,Hao Y
    A genome-wide analysis of the LBD (LATERAL ORGAN BOUNDARIES domain) gene family in Malus domestica with a functional characterization of MdLBD11.
    PLoS ONE, 2013. 8(2): p. e57044
    [PMID:23468909]
  22. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]