PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G62940.1
Common NameDOF5.6, HCA2, MQB2.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 372aa    MW: 39800.8 Da    PI: 8.1418
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G62940.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.3e-3970129362
       zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  AT5G62940.1  70 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 129
                  6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3458123IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3271127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.76173127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000036anatomyleaf vascular system
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0005017anatomyflower vascular system
PO:0005417anatomyphloem
PO:0005597anatomycambium
PO:0006202anatomyinterfascicular region
PO:0006203anatomypericycle
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGLTSLQVCM DSDWLQESES SGGSMLDSST NSPSAADILA ACSTRPQASA VAVAAAALMD  60
GGRRLRPPHD HPQKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVGG  120
GCRKNKKPSS SNSSSSTSSG KKPSNIVTAN TSDLMALAHS HQNYQHSPLG FSHFGGMMGS  180
YSTPEHGNVG FLESKYGGLL SQSPRPIDFL DSKFDLMGVN NDNLVMVNHG SNGDHHHHHN  240
HHMGLNHGVG LNNNNNNGGF NGISTGGNGN GGGLMDISTC QRLMLSNYDH HHYNHQEDHQ  300
RVATIMDVKP NPKLLSLDWQ QDQCYSNGGG SGGAGKSDGG GYGNGGYING LGSSWNGLMN  360
GYGTSTKTNS LV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.290260.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247397_at0.0
Expression AtlasAT5G62940-
AtGenExpressAT5G62940-
ATTED-IIAT5G62940-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the vascular tissues and pericycle of primary roots. Detected in the vasculature of the cotyledons, rosette leaves and cauline leaves. In flowers, localized in vasculature of petals, stigma, and stamen filaments, and, to a lower extent, in anthers and carpels. In inflorescence stems, accumulates in the vasculature, particularly in cambium, phloem, and interfascicular parenchyma cells. {ECO:0000269|PubMed:19915089}.
UniprotTISSUE SPECIFICITY: The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). Preferentially expressed in the vasculature of all organs, including seedlings, roots, stems, buds, leaves, flowers and siliques, and particularly in the cambium, phloem and interfascicular parenchyma cells of inflorescence stems (PubMed:19915089). {ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Functional Description ? help Back to Top
Source Description
TAIRHCA2 induces the formation of interfascicular cambium and regulates vascular tissue development in the aerial parts of the plant. Evidence from both gain of function and dominant negative alleles.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Function -- GeneRIF ? help Back to Top
  1. This report demonstrates that a transcription factor gene, HCA2, is involved in regulation of interfascicular cambium formation and vascular tissue development in Arabidopsis.[HCA2]
    [PMID: 19915089]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G62940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G62940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0204670.0BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankBT0205760.0BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201099.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ9FM030.0DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A178UF220.0A0A178UF22_ARATH; HCA2
STRINGAT5G62940.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  6. Guo Y,Qin G,Gu H,Qu LJ
    Dof5.6/HCA2, a Dof transcription factor gene, regulates interfascicular cambium formation and vascular tissue development in Arabidopsis.
    Plant Cell, 2009. 21(11): p. 3518-34
    [PMID:19915089]
  7. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]