PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G62430.1
Common NameCDF1, DOF5.5, K19B1.4, MMI9.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 298aa    MW: 33638.9 Da    PI: 9.1551
Description cycling DOF factor 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G62430.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.46.6e-3850109261
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                  ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt GG++r vP+G+grrknk++
  AT5G62430.1  50 PTKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKNKNN 109
                  67899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3836107IPR003851Zinc finger, Dof-type
PfamPF027012.6E-3152108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.27654108IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009908Biological Processflower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0002000anatomystomatal complex
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009015anatomyportion of vascular tissue
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MLETKDPAIK LFGMKIPFPT VLEVADEEEE KNQNKTLTDQ SEKDKTLKKP TKILPCPRCN  60
SMETKFCYYN NYNVNQPRHF CKACQRYWTS GGTMRSVPIG AGRRKNKNNS PTSHYHHVTI  120
SETNGPVLSF SLGDDQKVSS NRFGNQKLVA RIENNDERSN NNTSNGLNCF PGVSWPYTWN  180
PAFYPVYPYW SMPVLSSPVS SSPTSTLGKH SRDEDETVKQ KQRNGSVLVP KTLRIDDPNE  240
AAKSSIWTTL GIKNEVMFNG FGSKKEVKLS NKEETETSLV LCANPAALSR SINFHEQM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.93000.0flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453595580.0
Genevisible247452_at0.0
Expression AtlasAT5G62430-
AtGenExpressAT5G62430-
ATTED-IIAT5G62430-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vascular tissues of cotyledons, leaves and hypocotyls and in stomata. Not detected in roots. {ECO:0000269|PubMed:16002617}.
Functional Description ? help Back to Top
Source Description
TAIRDof-type zinc finger domain-containing protein, similar to H-protein promoter binding factor-2a GI:3386546 from (Arabidopsis thaliana). Represses expression of Constans (CO), a circadian regulator of flowering time. Interacts with LKP2 and FKF1. Expression oscillates under constant light conditions. Mainly expressed in the vasculature of cotyledons, leaves and hypocotyls, but also in stomata. Localized to the nucleus and acts as a repressor of CONSTANS through binding to the Dof binding sites in the CO promoter. Protein gets degraded by FKF1 in the afternoon.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. A flanking TGT sequence contributes to the specificity of binding. Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The DNA-binding ability is not modulated by 'GIGANTEA' but the stability of CDF1 is controlled by the proteasome-dependent pathway. Ubiquitinated by the SCF(ADO3) E3 ubiquitin ligase complex. Binds to the FT promoter in the morning. {ECO:0000269|PubMed:16002617, ECO:0000269|PubMed:19619493, ECO:0000269|PubMed:22628657}.
Function -- GeneRIF ? help Back to Top
  1. findings show that FKF1 controls daily CONSTANS expression in part by degrading CYCLING DOF FACTOR 1 (CDF1), a repressor of CONSTANS transcription [CDF1]
    [PMID: 16002617]
  2. Detailed expression studies followed by phenotypic assays showed that the CDFs function downstream of GI, influencing responses to freezing temperatures and growth, but are not necessary for proper clock function.
    [PMID: 25600594]
  3. represses transcription through the TOPLESS co-repressor to control photoperiodic flowering
    [PMID: 28752516]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G62430.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation at the protein level, but not at the mRNA level. Strongly decreased expression during the dark phase. Accumulates at high levels at the beginning of the day. {ECO:0000269|PubMed:16002617}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G65480(R), AT5G15840(R)
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8W1E3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G62430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2313330.0AB231333.1 Arabidopsis thaliana CDF1 mRNA for cyclic dof factor 1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201049.30.0cycling DOF factor 1
SwissprotQ8W1E30.0CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A178UAR40.0A0A178UAR4_ARATH; CDF1
STRINGAT5G62430.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139791625
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Imaizumi T,Schultz TF,Harmon FG,Ho LA,Kay SA
    FKF1 F-box protein mediates cyclic degradation of a repressor of CONSTANS in Arabidopsis.
    Science, 2005. 309(5732): p. 293-7
    [PMID:16002617]
  6. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  7. Chen M,Ni M
    RFI2, a RING-domain zinc finger protein, negatively regulates CONSTANS expression and photoperiodic flowering.
    Plant J., 2006. 46(5): p. 823-33
    [PMID:16709197]
  8. Nakamichi N, et al.
    Arabidopsis clock-associated pseudo-response regulators PRR9, PRR7 and PRR5 coordinately and positively regulate flowering time through the canonical CONSTANS-dependent photoperiodic pathway.
    Plant Cell Physiol., 2007. 48(6): p. 822-32
    [PMID:17504813]
  9. Sawa M,Nusinow DA,Kay SA,Imaizumi T
    FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis.
    Science, 2007. 318(5848): p. 261-5
    [PMID:17872410]
  10. Kobayashi Y,Weigel D
    Move on up, it's time for change--mobile signals controlling photoperiod-dependent flowering.
    Genes Dev., 2007. 21(19): p. 2371-84
    [PMID:17908925]
  11. Ito S, et al.
    Insight into missing genetic links between two evening-expressed pseudo-response regulator genes TOC1 and PRR5 in the circadian clock-controlled circuitry in Arabidopsis thaliana.
    Plant Cell Physiol., 2008. 49(2): p. 201-13
    [PMID:18178585]
  12. Abe M,Fujiwara M,Kurotani K,Yokoi S,Shimamoto K
    Identification of dynamin as an interactor of rice GIGANTEA by tandem affinity purification (TAP).
    Plant Cell Physiol., 2008. 49(3): p. 420-32
    [PMID:18296724]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Wu JF,Wang Y,Wu SH
    Two new clock proteins, LWD1 and LWD2, regulate Arabidopsis photoperiodic flowering.
    Plant Physiol., 2008. 148(2): p. 948-59
    [PMID:18676661]
  15. Buchovsky AS,Strasser B,Cerd
    Suppression of pleiotropic effects of functional cryptochrome genes by Terminal Flower 1.
    Genetics, 2008. 180(3): p. 1467-74
    [PMID:18791256]
  16. Fujiwara S, et al.
    Circadian clock proteins LHY and CCA1 regulate SVP protein accumulation to control flowering in Arabidopsis.
    Plant Cell, 2008. 20(11): p. 2960-71
    [PMID:19011118]
  17. Jackson SD
    Plant responses to photoperiod.
    New Phytol., 2009. 181(3): p. 517-31
    [PMID:19154317]
  18. Fornara F, et al.
    Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response.
    Dev. Cell, 2009. 17(1): p. 75-86
    [PMID:19619493]
  19. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  20. Takase T, et al.
    LOV KELCH PROTEIN2 and ZEITLUPE repress Arabidopsis photoperiodic flowering under non-inductive conditions, dependent on FLAVIN-BINDING KELCH REPEAT F-BOX1.
    Plant J., 2011. 67(4): p. 608-21
    [PMID:21518052]
  21. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  22. Ruckle ME,Burgoon LD,Lawrence LA,Sinkler CA,Larkin RM
    Plastids are major regulators of light signaling in Arabidopsis.
    Plant Physiol., 2012. 159(1): p. 366-90
    [PMID:22383539]
  23. Song YH,Smith RW,To BJ,Millar AJ,Imaizumi T
    FKF1 conveys timing information for CONSTANS stabilization in photoperiodic flowering.
    Science, 2012. 336(6084): p. 1045-9
    [PMID:22628657]
  24. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  25. Fornara F, et al.
    The GI-CDF module of Arabidopsis affects freezing tolerance and growth as well as flowering.
    Plant J., 2015. 81(5): p. 695-706
    [PMID:25600594]
  26. Seaton DD, et al.
    Linked circadian outputs control elongation growth and flowering in response to photoperiod and temperature.
    Mol. Syst. Biol., 2015. 11(1): p. 776
    [PMID:25600997]
  27. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  28. Goralogia GS, et al.
    CYCLING DOF FACTOR 1 represses transcription through the TOPLESS co-repressor to control photoperiodic flowering in Arabidopsis.
    Plant J., 2017. 92(2): p. 244-262
    [PMID:28752516]
  29. Henriques R, et al.
    The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering.
    New Phytol., 2017. 216(3): p. 854-867
    [PMID:28758689]
  30. Shiina T,Allison L,Maliga P
    rbcL Transcript levels in tobacco plastids are independent of light: reduced dark transcription rate is compensated by increased mRNA stability.
    Plant Cell, 1998. 10(10): p. 1713-22
    [PMID:9761797]