PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G62165.1
Common NameAGL42, FYF, MTG10.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24673.4 Da    PI: 9.957
Description AGAMOUS-like 42
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G62165.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.15.5e-29959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k+ien + rqvtfskRrng+lKKA+ELSvLCda+ ++iifs++g+lye+ss
  AT5G62165.1  9 KKIENATSRQVTFSKRRNGLLKKAYELSVLCDAQLSLIIFSQRGRLYEFSS 59
                 68***********************************************96 PP

2K-box66.96.7e-2377170497
        K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                   ++++ ++ + ++l+qe++ +  +ie L+  +R+llG+++ s+sl+eLq++ +qL++sl k+R++K +l++eq+e+l+ kek+l een +L++k
  AT5G62165.1  77 ETSNHDSQIHLQQLKQEASHMITKIELLEFHKRKLLGQGIASCSLEELQEIDSQLQRSLGKVRERKAQLFKEQLEKLKAKEKQLLEENVKLHQK 170
                  34444788899******************999************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.959161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-33386IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-30323IPR002100Transcription factor, MADS-box
CDDcd002655.66E-43378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-2284170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.14687177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0030154Biological Processcell differentiation
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020149anatomyquiescent center
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVRGKIEMKK IENATSRQVT FSKRRNGLLK KAYELSVLCD AQLSLIIFSQ RGRLYEFSSS  60
DMQKTIERYR KYTKDHETSN HDSQIHLQQL KQEASHMITK IELLEFHKRK LLGQGIASCS  120
LEELQEIDSQ LQRSLGKVRE RKAQLFKEQL EKLKAKEKQL LEENVKLHQK NVINPWRGSS  180
TDQQQEKYKV IDLNLEVETD LFIGLPNRNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-22182183Myocyte-specific enhancer factor 2B
1tqe_R4e-22182183Myocyte-specific enhancer factor 2B
1tqe_Q4e-22182183Myocyte-specific enhancer factor 2B
1tqe_P4e-22182183Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.263940.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247469_at0.0
Expression AtlasAT5G62165-
AtGenExpressAT5G62165-
ATTED-IIAT5G62165-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}.
UniprotTISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a MADS box transcription factor. Expressed in quiescent center.
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Function -- GeneRIF ? help Back to Top
  1. Role for AGL42 in the floral transition in the apical and axillary meristems.
    [PMID: 21609362]
  2. FYF controls floral senescence/abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA in Arabidopsis.
    [PMID: 21689171]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G62165.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G48150
IntActSearch Q9FIS1
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:21609362}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G62165
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412130.0AY141213.1 Arabidopsis thaliana MADS-box protein AGL42 mRNA, complete cds.
GenBankAY0965090.0AY096509.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds.
GenBankAY0660350.0AY066035.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds.
GenBankAY0652060.0AY065206.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds.
GenBankAY0542200.0AY054220.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001032123.11e-152protein AGAMOUS-like 42
RefseqNP_568952.11e-152protein AGAMOUS-like 42
RefseqNP_851247.11e-152protein AGAMOUS-like 42
SwissprotQ9FIS11e-154AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A0D3AYB01e-130A0A0D3AYB0_BRAOL; Uncharacterized protein
STRINGAT5G62165.11e-152(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Adai A, et al.
    Computational prediction of miRNAs in Arabidopsis thaliana.
    Genome Res., 2005. 15(1): p. 78-91
    [PMID:15632092]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  8. Nawy T, et al.
    Transcriptional profile of the Arabidopsis root quiescent center.
    Plant Cell, 2005. 17(7): p. 1908-25
    [PMID:15937229]
  9. Maher C,Stein L,Ware D
    Evolution of Arabidopsis microRNA families through duplication events.
    Genome Res., 2006. 16(4): p. 510-9
    [PMID:16520461]
  10. Helliwell CA,Wood CC,Robertson M,James Peacock W,Dennis ES
    The Arabidopsis FLC protein interacts directly in vivo with SOC1 and FT chromatin and is part of a high-molecular-weight protein complex.
    Plant J., 2006. 46(2): p. 183-92
    [PMID:16623882]
  11. Blakeslee JJ, et al.
    Specificity of RCN1-mediated protein phosphatase 2A regulation in meristem organization and stress response in roots.
    Plant Physiol., 2008. 146(2): p. 539-53
    [PMID:18162590]
  12. Hacham Y, et al.
    Brassinosteroid perception in the epidermis controls root meristem size.
    Development, 2011. 138(5): p. 839-48
    [PMID:21270053]
  13. Dorca-Fornell C, et al.
    The Arabidopsis SOC1-like genes AGL42, AGL71 and AGL72 promote flowering in the shoot apical and axillary meristems.
    Plant J., 2011. 67(6): p. 1006-17
    [PMID:21609362]
  14. Chen MK, et al.
    The MADS box gene, FOREVER YOUNG FLOWER, acts as a repressor controlling floral organ senescence and abscission in Arabidopsis.
    Plant J., 2011. 68(1): p. 168-85
    [PMID:21689171]
  15. Chen MK,Lee PF,Yang CH
    Delay of flower senescence and abscission in Arabidopsis transformed with an FOREVER YOUNG FLOWER homolog from Oncidium orchid.
    Plant Signal Behav, 2011. 6(11): p. 1841-3
    [PMID:22041990]