PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G61430.1
Common NameANAC100, ATNAC5, MFB13.6, NAC100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 336aa    MW: 38472.5 Da    PI: 8.2006
Description NAC domain containing protein 100
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G61430.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.35.9e-57161421129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL+kkv ++++++ ++i evd++k+ePw+Lp ++k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++
  AT5G61430.1  16 LPPGFRFHPTDEELITHYLHKKVLDTSFSA-KAIGEVDLNKSEPWELPWMAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR-GKS 111
                  79***************************9.89***************8888899***************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfy+grapkg+kt+Wvmheyrle
  AT5G61430.1 112 LVGMKKTLVFYRGRAPKGQKTNWVMHEYRLE 142
                  *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-6512166IPR003441NAC domain
PROSITE profilePS5100560.26916166IPR003441NAC domain
PfamPF023657.9E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
METFCGFQKE EEQMDLPPGF RFHPTDEELI THYLHKKVLD TSFSAKAIGE VDLNKSEPWE  60
LPWMAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIYRGK SLVGMKKTLV  120
FYRGRAPKGQ KTNWVMHEYR LEGKFSAHNL PKTAKNEWVI CRVFQKSAGG KKIPISSLIR  180
IGSLGTDFNP SLLPSLTDSS PYNDKTKTEP VYVPCFSNQT DQNQGTTLNC FSSPVLNSIQ  240
ADIFHRIPLY QTQSLQVSMN LQSPVLTQEH SVLHAMIENN RRQSLKTMSV SQETGVSTDM  300
NTDISSDFEF GKRRFDSQED PSSSTGPVDL EPFWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-551317217174NAC domain-containing protein 19
3swm_B2e-551317217174NAC domain-containing protein 19
3swm_C2e-551317217174NAC domain-containing protein 19
3swm_D2e-551317217174NAC domain-containing protein 19
3swp_A2e-551317217174NAC domain-containing protein 19
3swp_B2e-551317217174NAC domain-containing protein 19
3swp_C2e-551317217174NAC domain-containing protein 19
3swp_D2e-551317217174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.74610.0bud| leaf| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453595290.0
Genevisible247519_at0.0
Expression AtlasAT5G61430-
AtGenExpressAT5G61430-
ATTED-IIAT5G61430-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G61430.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDBrassinosteroid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G61430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0851020.0AY085102.1 Arabidopsis thaliana clone 12970 mRNA, complete sequence.
GenBankAY0814960.0AY081496.1 Arabidopsis thaliana NAM (no apical meristem)-like protein (MFB13.22) mRNA, complete cds.
GenBankAY0546440.0AY054644.1 Arabidopsis thaliana NAM (no apical meristem)-like protein (MFB13.22) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200951.10.0NAC domain containing protein 100
SwissprotQ9FLJ20.0NC100_ARATH; NAC domain-containing protein 100
TrEMBLD7MV190.0D7MV19_ARALL; ANAC100/ATNAC5
STRINGAT5G61430.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Laufs P,Peaucelle A,Morin H,Traas J
    MicroRNA regulation of the CUC genes is required for boundary size control in Arabidopsis meristems.
    Development, 2004. 131(17): p. 4311-22
    [PMID:15294871]
  5. Baker CC,Sieber P,Wellmer F,Meyerowitz EM
    The early extra petals1 mutant uncovers a role for microRNA miR164c in regulating petal number in Arabidopsis.
    Curr. Biol., 2005. 15(4): p. 303-15
    [PMID:15723790]
  6. Guo HS,Xie Q,Fei JF,Chua NH
    MicroRNA directs mRNA cleavage of the transcription factor NAC1 to downregulate auxin signals for arabidopsis lateral root development.
    Plant Cell, 2005. 17(5): p. 1376-86
    [PMID:15829603]
  7. Mlotshwa S, et al.
    Ectopic DICER-LIKE1 expression in P1/HC-Pro Arabidopsis rescues phenotypic anomalies but not defects in microRNA and silencing pathways.
    Plant Cell, 2005. 17(11): p. 2873-85
    [PMID:16214897]
  8. Alvarez JP, et al.
    Endogenous and synthetic microRNAs stimulate simultaneous, efficient, and localized regulation of multiple targets in diverse species.
    Plant Cell, 2006. 18(5): p. 1134-51
    [PMID:16603651]
  9. Nikovics K, et al.
    The balance between the MIR164A and CUC2 genes controls leaf margin serration in Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2929-45
    [PMID:17098808]
  10. Sieber P,Wellmer F,Gheyselinck J,Riechmann JL,Meyerowitz EM
    Redundancy and specialization among plant microRNAs: role of the MIR164 family in developmental robustness.
    Development, 2007. 134(6): p. 1051-60
    [PMID:17287247]
  11. Ehrenreich IM,Purugganan MD
    Sequence variation of MicroRNAs and their binding sites in Arabidopsis.
    Plant Physiol., 2008. 146(4): p. 1974-82
    [PMID:18305205]
  12. Raman S, et al.
    Interplay of miR164, CUP-SHAPED COTYLEDON genes and LATERAL SUPPRESSOR controls axillary meristem formation in Arabidopsis thaliana.
    Plant J., 2008. 55(1): p. 65-76
    [PMID:18346190]
  13. Pei H, et al.
    An NAC transcription factor controls ethylene-regulated cell expansion in flower petals.
    Plant Physiol., 2013. 163(2): p. 775-91
    [PMID:23933991]