PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G60890.1
Common NameATMYB34, ATR1, MSL3.10, MYB34
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 295aa    MW: 32742.6 Da    PI: 4.9866
Description myb domain protein 34
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G60890.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ + +++G g W+t +++ g++R++k+c++rw +yl
      AT5G60890.1 14 KGAWTPEEDQKLIAYLHLHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.44.5e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eEd+ +++++++ G++ W++Ia  +  gRt++++k++w++ 
      AT5G60890.1  67 RGEFSPEEDDTIIKLHALKGNK-WAAIATSLA-GRTDNEIKNYWNTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.288961IPR017930Myb domain
SuperFamilySSF466892.96E-2811108IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002494.9E-161461IPR001005SANT/Myb domain
CDDcd001671.55E-101661No hitNo description
PROSITE profilePS5129424.57962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2565117IPR009057Homeodomain-like
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002492.1E-1467112IPR001005SANT/Myb domain
CDDcd001673.20E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000162Biological Processtryptophan biosynthetic process
GO:0002213Biological Processdefense response to insect
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009753Biological Processresponse to jasmonic acid
GO:0009759Biological Processindole glucosinolate biosynthetic process
GO:0010438Biological Processcellular response to sulfur starvation
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0016301Molecular Functionkinase activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MVRTPCCKEE GIKKGAWTPE EDQKLIAYLH LHGEGGWRTL PEKAGLKRCG KSCRLRWANY  60
LRPDIKRGEF SPEEDDTIIK LHALKGNKWA AIATSLAGRT DNEIKNYWNT NLKKRLKQKG  120
IDAITHKPIN STGQTGFEPK VNKPVYSSGS ARLLNRVASK YAVELNRDLL TGIISGNSTV  180
AEDSQNSGDV DSPTSTLLNK MAATSVLINT TTTYSGFSDN CSFTDEFNEF FNNEEISDIY  240
TTVDNFGFME ELKSILSYGD ASAGVIENSP EVNVADAMEF IDSWNEDDNM VGVFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.84630.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247600_at0.0
Expression AtlasAT5G60890-
AtGenExpressAT5G60890-
ATTED-IIAT5G60890-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes. {ECO:0000269|PubMed:23115560}.
Functional Description ? help Back to Top
Source Description
TAIRMyb-like transcription factor that modulates expression of ASA1, a key point of control in the tryptophan pathway; mutant has deregulated expression of ASA1 in dominant allele. Loss of function allele suggests ATR1 also functions at a control point for regulating indole glucosinolate homeostasis.
UniProtTranscription factor involved in tryptophan gene activation and in indole-3-acetic acid (IAA) and indolic glucosinolates (IG) biosynthesis. Acts as a direct transcriptional activator of both Trp synthesis genes and Trp secondary metabolism genes. {ECO:0000269|PubMed:15579661, ECO:0000269|PubMed:23580754, ECO:0000269|PubMed:23943862, ECO:0000269|PubMed:9576939}.
Function -- GeneRIF ? help Back to Top
  1. The role of ATR1 in the expression of mulitple gene affecting tryptophan metabolism.
    [PMID: 15579661]
  2. Results conclude that ATR1 positively contribute to pathogen virulence inside host cells.
    [PMID: 18165328]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G60890.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by herbivory. {ECO:0000269|PubMed:23943862}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G73730 (R), AT2G38470 (R), AT5G07100 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G20610(A), AT2G22330(A), AT4G31500(A), AT4G39950(A), AT5G05730(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G32640
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. Reduced indolic glucosinolate levels in adult leaves and loss of responses to brassinosteroids. {ECO:0000269|PubMed:15579661, ECO:0000269|PubMed:23580754}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G60890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196420.0AY519642.1 Arabidopsis thaliana MYB transcription factor (At5g60890) mRNA, complete cds.
GenBankBT0303260.0BT030326.1 Arabidopsis thaliana unknown protein (At5g60890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200897.10.0myb domain protein 34
SwissprotO643990.0MYB34_ARATH; Transcription factor MYB34
TrEMBLD7MUF20.0D7MUF2_ARALL; Uncharacterized protein
STRINGAT5G60890.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93311637
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Bae MS,Cho EJ,Choi EY,Park OK
    Analysis of the Arabidopsis nuclear proteome and its response to cold stress.
    Plant J., 2003. 36(5): p. 652-63
    [PMID:14617066]
  4. Celenza JL, et al.
    The Arabidopsis ATR1 Myb transcription factor controls indolic glucosinolate homeostasis.
    Plant Physiol., 2005. 137(1): p. 253-62
    [PMID:15579661]
  5. Grubb CD,Abel S
    Glucosinolate metabolism and its control.
    Trends Plant Sci., 2006. 11(2): p. 89-100
    [PMID:16406306]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Skirycz A, et al.
    DOF transcription factor AtDof1.1 (OBP2) is part of a regulatory network controlling glucosinolate biosynthesis in Arabidopsis.
    Plant J., 2006. 47(1): p. 10-24
    [PMID:16740150]
  8. Maruyama-Nakashita A,Nakamura Y,Tohge T,Saito K,Takahashi H
    Arabidopsis SLIM1 is a central transcriptional regulator of plant sulfur response and metabolism.
    Plant Cell, 2006. 18(11): p. 3235-51
    [PMID:17114350]
  9. De Schutter K, et al.
    Arabidopsis WEE1 kinase controls cell cycle arrest in response to activation of the DNA integrity checkpoint.
    Plant Cell, 2007. 19(1): p. 211-25
    [PMID:17209125]
  10. Hirai MY, et al.
    Omics-based identification of Arabidopsis Myb transcription factors regulating aliphatic glucosinolate biosynthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(15): p. 6478-83
    [PMID:17420480]
  11. Gigolashvili T, et al.
    The transcription factor HIG1/MYB51 regulates indolic glucosinolate biosynthesis in Arabidopsis thaliana.
    Plant J., 2007. 50(5): p. 886-901
    [PMID:17461791]
  12. Dombrecht B, et al.
    MYC2 differentially modulates diverse jasmonate-dependent functions in Arabidopsis.
    Plant Cell, 2007. 19(7): p. 2225-45
    [PMID:17616737]
  13. Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI
    HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana.
    New Phytol., 2008. 177(3): p. 627-42
    [PMID:18042203]
  14. Sohn KH,Lei R,Nemri A,Jones JD
    The downy mildew effector proteins ATR1 and ATR13 promote disease susceptibility in Arabidopsis thaliana.
    Plant Cell, 2007. 19(12): p. 4077-90
    [PMID:18165328]
  15. Kim JH,Lee BW,Schroeder FC,Jander G
    Identification of indole glucosinolate breakdown products with antifeedant effects on Myzus persicae (green peach aphid).
    Plant J., 2008. 54(6): p. 1015-26
    [PMID:18346197]
  16. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  17. Malitsky S, et al.
    The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators.
    Plant Physiol., 2008. 148(4): p. 2021-49
    [PMID:18829985]
  18. Kim K,Jiang K,Teng SL,Feldman LJ,Huang H
    Using biologically interrelated experiments to identify pathway genes in Arabidopsis.
    Bioinformatics, 2012. 28(6): p. 815-22
    [PMID:22271267]
  19. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  20. Frerigmann H,B
    Glucosinolates are produced in trichomes of Arabidopsis thaliana.
    Front Plant Sci, 2012. 3: p. 242
    [PMID:23115560]
  21. Guo R, et al.
    BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis.
    J. Exp. Bot., 2013. 64(8): p. 2401-12
    [PMID:23580754]
  22. W
    LEAFY COTYLEDON2 (LEC2) promotes embryogenic induction in somatic tissues of Arabidopsis, via YUCCA-mediated auxin biosynthesis.
    Planta, 2013. 238(3): p. 425-40
    [PMID:23722561]
  23. Schweizer F, et al.
    Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior.
    Plant Cell, 2013. 25(8): p. 3117-32
    [PMID:23943862]
  24. Guo R, et al.
    Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(18): p. 5707-19
    [PMID:24151308]
  25. Benstein RM, et al.
    Arabidopsis phosphoglycerate dehydrogenase1 of the phosphoserine pathway is essential for development and required for ammonium assimilation and tryptophan biosynthesis.
    Plant Cell, 2013. 25(12): p. 5011-29
    [PMID:24368794]
  26. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  27. Frerigmann H,Gigolashvili T
    MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana.
    Mol Plant, 2014. 7(5): p. 814-28
    [PMID:24431192]
  28. Frerigmann H,Berger B,Gigolashvili T
    bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis.
    Plant Physiol., 2014. 166(1): p. 349-69
    [PMID:25049362]
  29. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  30. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  31. Frerigmann H,Glawischnig E,Gigolashvili T
    The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana.
    Front Plant Sci, 2015. 6: p. 654
    [PMID:26379682]
  32. Frerigmann H, et al.
    Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products.
    Mol Plant, 2016. 9(5): p. 682-695
    [PMID:26802248]
  33. Stahl E, et al.
    Regulatory and Functional Aspects of Indolic Metabolism in Plant Systemic Acquired Resistance.
    Mol Plant, 2016. 9(5): p. 662-681
    [PMID:26802249]
  34. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  35. Miao H, et al.
    Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation.
    Sci Rep, 2016. 6: p. 31854
    [PMID:27549907]
  36. Walker JC
    Receptor-like protein kinase genes of Arabidopsis thaliana.
    Plant J., 1993. 3(3): p. 451-6
    [PMID:8220453]
  37. Bender J,Fink GR
    A Myb homologue, ATR1, activates tryptophan gene expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 1998. 95(10): p. 5655-60
    [PMID:9576939]
  38. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]