PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G60850.1
Common NameDOF5.4, MAE1.9, OBP4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 307aa    MW: 32740.8 Da    PI: 7.0459
Description OBF binding protein 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G60850.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-3847107262
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  ++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  AT5G60850.1  47 HHQSLKCPRCNSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 107
                  57899****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3538105IPR003851Zinc finger, Dof-type
PfamPF027015.7E-3349105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.53451105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MQDIHDFSMN GVGGGGGGGG RFFGGGIGGG GGGDRRMRAH QNNILNHHQS LKCPRCNSLN  60
TKFCYYNNYN LSQPRHFCKN CRRYWTKGGV LRNVPVGGGC RKAKRSKTKQ VPSSSSADKP  120
TTTQDDHHVE EKSSTGSHSS SESSSLTASN STTVAAVSVT AAAEVASSVI PGFDMPNMKI  180
YGNGIEWSTL LGQGSSAGGV FSEIGGFPAV SAIETTPFGF GGKFVNQDDH LKLEGETVQQ  240
QQFGDRTAQV EFQGRSSDPN MGFEPLDWGS GGGDQTLFDL TSTVDHAYWS QSQWTSSDQD  300
QSGLYLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11825GGRFFGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.202190.0flower| inflorescence| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453595010.0
Genevisible247601_at0.0
Expression AtlasAT5G60850-
AtGenExpressAT5G60850-
ATTED-IIAT5G60850-
Functional Description ? help Back to Top
Source Description
TAIREncodes a zinc finger protein.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G60850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G60850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAY0858560.0AY085856.1 Arabidopsis thaliana clone 19080 mRNA, complete sequence.
GenBankAY0817090.0AY081709.1 Arabidopsis thaliana AT5g60850/mae1_100 mRNA, complete cds.
GenBankAY0564130.0AY056413.1 Arabidopsis thaliana AT5g60850/mae1_100 mRNA, complete cds.
GenBankAB0154720.0AB015472.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MAE1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200893.10.0OBF binding protein 4
SwissprotQ8LDR00.0DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLQ0WUB60.0Q0WUB6_ARATH; Zinc finger protein OBP4-like
STRINGAT5G60850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MalvidsOGEM44822656
Publications ? help Back to Top
  1. Kang HG,Singh KB
    Characterization of salicylic acid-responsive, arabidopsis Dof domain proteins: overexpression of OBP3 leads to growth defects.
    Plant J., 2000. 21(4): p. 329-39
    [PMID:10758484]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  4. Park DH, et al.
    The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling.
    Plant J., 2003. 34(2): p. 161-71
    [PMID:12694592]
  5. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Coupe SA, et al.
    Systemic signalling of environmental cues in Arabidopsis leaves.
    J. Exp. Bot., 2006. 57(2): p. 329-41
    [PMID:16330523]
  8. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  9. Moreno-Risueno MA,Mart
    The family of DOF transcription factors: from green unicellular algae to vascular plants.
    Mol. Genet. Genomics, 2007. 277(4): p. 379-90
    [PMID:17180359]
  10. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  11. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  12. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]