PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G60440.1
Common NameAGL62, MUF9.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 299aa    MW: 34587.8 Da    PI: 9.1805
Description AGAMOUS-like 62
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G60440.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.92.4e-221662349
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  +n+sn qvtfskRr g++KKA+EL++LC+aeva+++fs+  k++ +
  AT5G60440.1 16 MKNESNLQVTFSKRRSGLFKKASELCTLCGAEVAIVVFSPGRKVFSF 62
                 589*************************************9999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.32666IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-31665IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-28786IPR002100Transcription factor, MADS-box
CDDcd002651.69E-33778No hitNo description
PRINTSPR004041.3E-18828IPR002100Transcription factor, MADS-box
PfamPF003191.7E-241662IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009089anatomyendosperm
PO:0020093anatomyantipodal cell
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MVKKSKGRQK IEMVKMKNES NLQVTFSKRR SGLFKKASEL CTLCGAEVAI VVFSPGRKVF  60
SFGHPNVDSV IDRFINNNPL PPHQHNNMQL RETRRNSIVQ DLNNHLTQVL SQLETEKKKY  120
DELKKIREKT KALGNWWEDP VEELALSQLE GFKGNLENLK KVVTVEASRF FQANVPNFYV  180
GSSSNNAAFG IDDGSHINPD MDLFSQRRMM DINAFNYNQN QIHPNHALPP FGNNAYGINE  240
GFVPEYNVNF RPEYNPNQNQ IQNQNQVQIQ IQNQSFKREN ISEYEHHHGY PPQSRSDYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A5e-15784176MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B5e-15784176MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402564630.0
Genevisible247631_at0.0
Expression AtlasAT5G60440-
AtGenExpressAT5G60440-
ATTED-IIAT5G60440-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}.
UniprotTISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}.
Functional Description ? help Back to Top
Source Description
TAIRAGL62 encodes a Type I MADS domain protein that likely functions as a transcription factor. It is expressed AGL62 is expressed exclusively in the endosperm. AGL62 supresses suppresses cellularization during the syncytial phase of endosperm development.
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Function -- GeneRIF ? help Back to Top
  1. Data suggest that AGL62 suppresses cellularization during the syncytial phase of endosperm development and that endosperm cellularization is triggered via direct or indirect AGL62 inactivation by the FIS polycomb complex.
    [PMID: 18334668]
  2. AGL62 is a direct target gene of FIS Polycomb group repressive complex 2 (PRC2), establishing the molecular basis for FIS PRC2-mediated endosperm cellularization.
    [PMID: 22535409]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G60440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G31630, AT1G31640, AT1G46408, AT1G65300, AT1G65330
IntActSearch Q9FKK2
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G60440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU4930930.0EU493093.1 Arabidopsis thaliana MADS-box protein AGL62 (AGL62) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200852.10.0agamous-like MADS-box protein AGL62
SwissprotQ9FKK20.0AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLD7MTU51e-180D7MTU5_ARALL; MADS-box protein
STRINGAT5G60440.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  7. Kang IH,Steffen JG,Portereiko MF,Lloyd A,Drews GN
    The AGL62 MADS domain protein regulates cellularization during endosperm development in Arabidopsis.
    Plant Cell, 2008. 20(3): p. 635-47
    [PMID:18334668]
  8. Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC
    The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules.
    Plant Cell, 2008. 20(8): p. 2088-101
    [PMID:18713950]
  9. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  10. Walia H, et al.
    Dosage-dependent deregulation of an AGAMOUS-LIKE gene cluster contributes to interspecific incompatibility.
    Curr. Biol., 2009. 19(13): p. 1128-32
    [PMID:19559614]
  11. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  12. Roszak P,K
    Polycomb group proteins are required to couple seed coat initiation to fertilization.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(51): p. 20826-31
    [PMID:22143805]
  13. Hehenberger E,Kradolfer D,K
    Endosperm cellularization defines an important developmental transition for embryo development.
    Development, 2012. 139(11): p. 2031-9
    [PMID:22535409]
  14. Ngo QA, et al.
    The Armadillo repeat gene ZAK IXIK promotes Arabidopsis early embryo and endosperm development through a distinctive gametophytic maternal effect.
    Plant Cell, 2012. 24(10): p. 4026-43
    [PMID:23064319]
  15. Kradolfer D,Hennig L,K
    Increased maternal genome dosage bypasses the requirement of the FIS polycomb repressive complex 2 in Arabidopsis seed development.
    PLoS Genet., 2013. 9(1): p. e1003163
    [PMID:23326241]