PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G60200.1
Common NameDOF5.3, F15L12.9, TMO6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 257aa    MW: 28201.3 Da    PI: 8.7682
Description TARGET OF MONOPTEROS 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G60200.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-3953111462
       zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                   al+cprCdstntkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknk+s+
  AT5G60200.1  53 LALRCPRCDSTNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKRST 111
                  5789****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3148108IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3355109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4555109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003015anatomyprimary root differentiation zone
PO:0005417anatomyphloem
PO:0006203anatomypericycle
PO:0008011anatomyembryo vascular system
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020124anatomyroot stele
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025257anatomyprimary root elongation zone
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDHLLQHQDV FGNYNKAREA MGLSYSSNPT PLDNDQKKPS PATAVTRPQP PELALRCPRC  60
DSTNTKFCYY NNYSLTQPRY FCKSCRRYWT KGGTLRNIPV GGGCRKNKRS TSSAARSLRT  120
TPEPASHDGK VFSAAGFNGY SNNEHIDLSL AFALLNKQHP GSSSQLGFHS ELGSSHQSDM  180
EGMFGTSQQK ENATYAFGNG SSGLGDPSRV LWGFPWQMNG ESFGMMNIGG GGGHVDQIDS  240
GREMWTNMNY INSGALM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.291770.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425686670.0
Genevisible247625_at0.0
Expression AtlasAT5G60200-
AtGenExpressAT5G60200-
ATTED-IIAT5G60200-
Functional Description ? help Back to Top
Source Description
TAIREncodes a Dof-type transcription factor.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Data show that the expression of 3 DOF genes DOF2.1 (At2g28510), DOF4.6 (At4g24060) and DOF5.3 (At5g60200) is activated at early vascular development stages overlapping onset of ATHB8 expression.
    [PMID: 20563990]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G60200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G60200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0058660.0BT005866.1 Arabidopsis thaliana At5g60200 gene, complete cds.
GenBankAK2281850.0AK228185.1 Arabidopsis thaliana mRNA for zinc finger protein - like, complete cds, clone: RAFL14-63-H23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568920.10.0Dof-type transcription factor TMO6
SwissprotQ84TE90.0DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLQ0WRV90.0Q0WRV9_ARATH; Putative uncharacterized protein At5g60200
STRINGAT5G60200.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61321845
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  7. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  8. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  9. Schlereth A, et al.
    MONOPTEROS controls embryonic root initiation by regulating a mobile transcription factor.
    Nature, 2010. 464(7290): p. 913-6
    [PMID:20220754]
  10. Gardiner J,Sherr I,Scarpella E
    Expression of DOF genes identifies early stages of vascular development in Arabidopsis leaves.
    Int. J. Dev. Biol., 2010. 54(8-9): p. 1389-96
    [PMID:20563990]
  11. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  12. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]