PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G59340.1
Common NameMNC17.25, WOX2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 260aa    MW: 29183.4 Da    PI: 9.3081
Description WUSCHEL related homeobox 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G59340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.9e-201372357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++tk+q++ Le+l+++  r+psa+++++++ +l    +++ ++V++WFqN++a++++
  AT5G59340.1 13 SRWNPTKDQITLLENLYKEgIRTPSADQIQQITGRLraygHIEGKNVFYWFQNHKARQRQ 72
                 8*****************99**************************************97 PP

2Wus_type_Homeobox115.23.2e-371174265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt++Qi++Le+lyk+G+rtP++++iq+it +L++yG+ie+kNVfyWFQN+kaR+rqkq
        AT5G59340.1 11 SSSRWNPTKDQITLLENLYKEGIRTPSADQIQQITGRLRAYGHIEGKNVFYWFQNHKARQRQKQ 74
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-12779IPR009057Homeodomain-like
PROSITE profilePS5007110.787873IPR001356Homeobox domain
SMARTSM003894.7E-51077IPR001356Homeobox domain
PfamPF000467.9E-181372IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-71372IPR009057Homeodomain-like
CDDcd000868.85E-61474No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000423anatomyplant zygote
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020094anatomyplant egg cell
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025284anatomyembryo apical cell
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MENEVNAGTA SSSRWNPTKD QITLLENLYK EGIRTPSADQ IQQITGRLRA YGHIEGKNVF  60
YWFQNHKARQ RQKQKQERMA YFNRLLHKTS RFFYPPPCSN VGCVSPYYLQ QASDHHMNQH  120
GSVYTNDLLH RNNVMIPSGG YEKRTVTQHQ KQLSDIRTTA ATRMPISPSS LRFDRFALRD  180
NCYAGEDINV NSSGRKTLPL FPLQPLNASN ADGMGSSSFA LGSDSPVDCS SDGAGREQPF  240
IDFFSGGSTS TRFDSNGNGL
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247714_at0.0
Expression AtlasAT5G59340-
AtGenExpressAT5G59340-
ATTED-IIAT5G59340-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the egg cell and the central cell of the embryo sac, but not in the synergids, the antipodals or the male gametophyte. After fertilization, it is expressed in the zygote. After the first division of the zygote, it is detected exclusively in the apical daughter cell, while WOX8 is expressed in the basal daughter cell. Subsequently, it is expressed in all cells of the 4-cell embryo proper and predominantly in the apical domain of the 8-cell embryo. However, in some 8-cell embryos it is also weakly expressed in the central domain suggesting that expression shifts to the most apical cells during this stage. Expression remains restricted to the apical domain in the 16-cell embryo and the early-globular stage. Not expressed in the apical domain thereafter. However, in heart stage embryos it is weakly expressed in a ring of epidermal cells approximately at the junction of hypocotyl and root. Not expressed in mature embryos, endosperm or postembryonically in inflorescences. {ECO:0000269|PubMed:14711878}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. WOX2 has a putative Zinc finger domain downstream of the homeodomain. Transcripts are expressed in the egg cell, the zygote and the apical cell lineage and are reduced in met3-1 early embryos. This gene is necessary for cell divisions that form the apical embryo domain.
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Function -- GeneRIF ? help Back to Top
  1. combinatorial action of WOX transcription factors is essential for Arabidopsis embryonic development.
    [PMID: 17706632]
  2. Differential expression of WOX2 gene mediates apical-basal axis formation in the Arabidopsis embryo.
    [PMID: 18539115]
  3. Loss of WOX2 and WOX8 lead to the development of partially fused cotyledons.
    [PMID: 22827849]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G59340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT5G45980 (A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G59340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513930.0AY251393.1 Arabidopsis thaliana clone 2 WOX2 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200742.20.0WUSCHEL related homeobox 2
SwissprotQ6X7K10.0WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLC0SVU60.0C0SVU6_ARATH; Uncharacterized protein At5g59340 (Fragment)
STRINGAT5G59340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69142844
Representative plantOGRP85821116
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Wang D,Harper JF,Gribskov M
    Systematic trans-genomic comparison of protein kinases between Arabidopsis and Saccharomyces cerevisiae.
    Plant Physiol., 2003. 132(4): p. 2152-65
    [PMID:12913170]
  3. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  4. Sottosanto JB,Gelli A,Blumwald E
    DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression.
    Plant J., 2004. 40(5): p. 752-71
    [PMID:15546358]
  5. Wu X,Chory J,Weigel D
    Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development.
    Dev. Biol., 2007. 309(2): p. 306-16
    [PMID:17706632]
  6. Breuninger H,Rikirsch E,Hermann M,Ueda M,Laux T
    Differential expression of WOX genes mediates apical-basal axis formation in the Arabidopsis embryo.
    Dev. Cell, 2008. 14(6): p. 867-76
    [PMID:18539115]
  7. Gebert M,Dresselhaus T,Sprunck S
    F-actin organization and pollen tube tip growth in Arabidopsis are dependent on the gametophyte-specific Armadillo repeat protein ARO1.
    Plant Cell, 2008. 20(10): p. 2798-814
    [PMID:18931021]
  8. Palovaara J,Hakman I
    WOX2 and polar auxin transport during spruce embryo pattern formation.
    Plant Signal Behav, 2009. 4(2): p. 153-5
    [PMID:19649198]
  9. Nelson DC, et al.
    Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100
    [PMID:20351290]
  10. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  11. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  12. Ueda M,Zhang Z,Laux T
    Transcriptional activation of Arabidopsis axis patterning genes WOX8/9 links zygote polarity to embryo development.
    Dev. Cell, 2011. 20(2): p. 264-70
    [PMID:21316593]
  13. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  14. Lie C,Kelsom C,Wu X
    WOX2 and STIMPY-LIKE/WOX8 promote cotyledon boundary formation in Arabidopsis.
    Plant J., 2012. 72(4): p. 674-82
    [PMID:22827849]
  15. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  16. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  17. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  18. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]