PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G57660.1
Common NameATCOL5, BBX6, COL5, MRI1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 355aa    MW: 38820.4 Da    PI: 6.4276
Description CONSTANS-like 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G57660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.36.4e-081957339
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htv 39
                 +r C+ +++  +  fC+ ++ +lC  C + +H+   H++
  AT5G57660.1 19 ARSCDACKSVTAAVFCRVDSAFLCIACDTRIHSFtrHER 57
                 578******99*********************6577876 PP

2zf-B_box26.71.2e-0858103342
     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                   ++C+ +e+ ++   C+ +   lC +C   +H+       H++vp+
  AT5G57660.1  58 VWVCEVCEQAPAAVTCKADAAALCVSCDADIHSAnplasrHERVPV 103
                  689*****************************66999999999986 PP

3CCT706.1e-24285328144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  AT5G57660.1 285 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 328
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.6E-61760IPR000315B-box-type zinc finger
PROSITE profilePS5011910.041760IPR000315B-box-type zinc finger
PfamPF006432.8E-62057IPR000315B-box-type zinc finger
CDDcd000217.11E-92060No hitNo description
PROSITE profilePS5011910.6856103IPR000315B-box-type zinc finger
PfamPF006436.6E-757103IPR000315B-box-type zinc finger
CDDcd000218.48E-959103No hitNo description
SMARTSM003361.7E-961103IPR000315B-box-type zinc finger
PROSITE profilePS5101716.817285327IPR010402CCT domain
PfamPF062035.5E-18285327IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGFGLESIKS ISGGWGAAAR SCDACKSVTA AVFCRVDSAF LCIACDTRIH SFTRHERVWV  60
CEVCEQAPAA VTCKADAAAL CVSCDADIHS ANPLASRHER VPVETFFDSA ETAVAKISAS  120
STFGILGSST TVDLTAVPVM ADDLGLCPWL LPNDFNEPAK IEIGTENMKG SSDFMFSDFD  180
RLIDFEFPNS FNHHQNNAGG DSLVPVQTKT EPLPLTNNDH CFDIDFCRSK LSAFTYPSQS  240
VSHSVSTSSI EYGVVPDGNT NNSVNRSTIT SSTTGGDHQA SSMDREARVL RYREKRKNRK  300
FEKTIRYASR KAYAESRPRI KGRFAKRTET ENDDIFLSHV YASAAHAQYG VVPTF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.207970.0leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306969050.0
Genevisible247921_at0.0
Expression AtlasAT5G57660-
AtGenExpressAT5G57660-
ATTED-IIAT5G57660-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G57660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FHH8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G57660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0576320.0AY057632.1 Arabidopsis thaliana AT5g57660/MRI1_1 mRNA, complete cds.
GenBankAY0807470.0AY080747.1 Arabidopsis thaliana putative CONSTANS B-box zinc finger protein (At5g57660) mRNA, complete cds.
GenBankAY1140060.0AY114006.1 Arabidopsis thaliana putative CONSTANS B-box zinc finger protein (At5g57660) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568863.10.0CONSTANS-like 5
SwissprotQ9FHH80.0COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A178U9620.0A0A178U962_ARATH; COL5
STRINGAT5G57660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Representative plantOGRP6911767
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Zik M,Irish VF
    Global identification of target genes regulated by APETALA3 and PISTILLATA floral homeotic gene action.
    Plant Cell, 2003. 15(1): p. 207-22
    [PMID:12509532]
  4. Izawa T,Takahashi Y,Yano M
    Comparative biology comes into bloom: genomic and genetic comparison of flowering pathways in rice and Arabidopsis.
    Curr. Opin. Plant Biol., 2003. 6(2): p. 113-20
    [PMID:12667866]
  5. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Fukamatsu Y, et al.
    Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
    Plant Cell Physiol., 2005. 46(8): p. 1340-9
    [PMID:15937324]
  8. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  9. Sottosanto JB,Saranga Y,Blumwald E
    Impact of AtNHX1, a vacuolar Na+/H+ antiporter, upon gene expression during short- and long-term salt stress in Arabidopsis thaliana.
    BMC Plant Biol., 2007. 7: p. 18
    [PMID:17411438]
  10. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  11. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  12. Hassidim M,Harir Y,Yakir E,Kron I,Green RM
    Over-expression of CONSTANS-LIKE 5 can induce flowering in short-day grown Arabidopsis.
    Planta, 2009. 230(3): p. 481-91
    [PMID:19504268]
  13. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  14. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  15. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  16. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]