PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G57620.1
Common NameAtMYB36, MUA2.20, MYB36
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 333aa    MW: 37980.4 Da    PI: 8.3143
Description myb domain protein 36
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G57620.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d++ ++G+g +W + ++++g++R++k+c++rw++yl
      AT5G57620.1 14 KGPWSPEEDVKLKDYIDKYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.52.7e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
      AT5G57620.1  69 GGFSEEEDRIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.519962IPR017930Myb domain
SuperFamilySSF466892.95E-2711109IPR009057Homeodomain-like
SMARTSM007172.6E-121364IPR001005SANT/Myb domain
PfamPF002492.8E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-241569IPR009057Homeodomain-like
CDDcd001671.33E-81662No hitNo description
PROSITE profilePS5129422.01563117IPR017930Myb domain
SMARTSM007175.3E-1267115IPR001005SANT/Myb domain
PfamPF002494.8E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2370117IPR009057Homeodomain-like
CDDcd001671.90E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0005634Cellular Componentnucleus
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0020100anatomyhypocotyl
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDVKLKDYID KYGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDRIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGR  120
QKQMNRQDSI TDSTENNLSN NNNNKSPQNL SNSALERLQL HMQLQNLQSP FSSFYNNPIL  180
WPKLHPLLQS TTTNQNPKLA SQESFHPLGV NVDHQHNNTK LAQINNGASS LYSENVEQSQ  240
NPAHEFQPNF GFSQDLRLDN HNMDFMNRGV SKELFQVGNE FELTNGSSWW SEEVELERKT  300
TSSSSWGSAS VLDQTTEGMV MLQDYAQMSY HSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25141177108B-MYB
1h8a_C5e-251411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.74890.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247868_at0.0
Expression AtlasAT5G57620-
AtGenExpressAT5G57620-
ATTED-IIAT5G57620-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In roots, expressed in endodermal cells from the late elongation zones to the differentiation zone and, to a lower extent, in endodermal cells of the meristematic zone. {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}.
UniprotTISSUE SPECIFICITY: Expressed in leaves, roots (endodermis-specific) and seedlings. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322, ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB36).
UniProtTranscription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}.
Function -- GeneRIF ? help Back to Top
  1. MYB36 is controlling expression of the machinery required to locally polymerize lignin in a fine band in the cell wall for the formation of the Casparian strip
    [PMID: 26124109]
  2. MYB36 regulates the transition from proliferation to differentiation in the Arabidopsis root.
    [PMID: 26371322]
  3. These results uncover a role for MYB36 outside the endodermis during lateral root primordia development.
    [PMID: 27891649]
  4. results uncover a role for MYB36 outside the endodermis during LRP development through a mechanism analogous to regulating the proliferation/differentiation transition in the root meristem.
    [PMID: 27891649]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G57620.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: In myb36-1, myb36-2 and myb36-4, impaired Casparian strips formation replaced by ectopic lignin-like material in the corners of endodermal cells, associated with reduced expression of several endodermis-specific genes and abnormal CASP1 localization in the plasma membrane (PubMed:26124109, PubMed:26371322). Multiple changes to leaf ionome, including elevated concentrations of sodium, magnesium, and zinc and decreased calcium, manganese, and iron. Longer root hairs (PubMed:26124109). Delayed and defective barrier (Casparian strips) formation as well as extra cell divisions in the meristem in roots (PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G57620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196400.0AY519640.1 Arabidopsis thaliana MYB transcription factor (At5g57620) mRNA, complete cds.
GenBankBT0303310.0BT030331.1 Arabidopsis thaliana unknown protein (At5g57620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200570.10.0myb domain protein 36
SwissprotQ9FKL20.0MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A178UPL30.0A0A178UPL3_ARATH; MYB36
STRINGAT5G57620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78982639
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Che P,Gingerich DJ,Lall S,Howell SH
    Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2771-85
    [PMID:12417700]
  4. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  5. Johnson KL,Jones BJ,Bacic A,Schultz CJ
    The fasciclin-like arabinogalactan proteins of Arabidopsis. A multigene family of putative cell adhesion molecules.
    Plant Physiol., 2003. 133(4): p. 1911-25
    [PMID:14645732]
  6. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  7. Müller D,Schmitz G,Theres K
    Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis.
    Plant Cell, 2006. 18(3): p. 586-97
    [PMID:16461581]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Cui H,Kong D,Liu X,Hao Y
    SCARECROW, SCR-LIKE 23 and SHORT-ROOT control bundle sheath cell fate and function in Arabidopsis thaliana.
    Plant J., 2014. 78(2): p. 319-27
    [PMID:24517883]
  10. Kamiya T, et al.
    The MYB36 transcription factor orchestrates Casparian strip formation.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(33): p. 10533-8
    [PMID:26124109]
  11. Liberman LM,Sparks EE,Moreno-Risueno MA,Petricka JJ,Benfey PN
    MYB36 regulates the transition from proliferation to differentiation in the Arabidopsis root.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(39): p. 12099-104
    [PMID:26371322]
  12. Fernández-Marcos M, et al.
    Control of Arabidopsis lateral root primordium boundaries by MYB36.
    New Phytol., 2017. 213(1): p. 105-112
    [PMID:27891649]
  13. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]