PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G56840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 233aa    MW: 25316.7 Da    PI: 10.5044
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G56840.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.9e-1292136347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r +  ++++ q+ s+ qky
      AT5G56840.1  92 PWTAEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKY 136
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.73784141IPR017930Myb domain
SuperFamilySSF466895.31E-1687141IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-1788140IPR006447Myb domain, plants
SMARTSM007172.4E-889139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-989135IPR009057Homeodomain-like
CDDcd001677.50E-892137No hitNo description
PfamPF002497.4E-1092136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGRRCSHCGN VGHNSRTCSS YQTRVVRLFG VHLDTTSSSP PPPPPPSILA AAIKKSFSMD  60
CLPACSSSSS SFAGYLSDGL AHKTPDRKKG VPWTAEEHRT FLIGLEKLGK GDWRGISRNF  120
VVTKSPTQVA SHAQKYFLRQ TTTLHHKRRR TSLFDMVSAG NVEENSTTKR ICNDHIGSSS  180
KVVWKQGLLN PRLGYPDPKV SVSGSGNSGG LDLELKLASI QSPESNIRPI SVT
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453593350.0
Expression AtlasAT5G56840-
AtGenExpressAT5G56840-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G56840.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G56840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195170.0AY519517.1 Arabidopsis thaliana MYB transcription factor (At5g56840) mRNA, complete cds.
GenBankBT0125280.0BT012528.1 Arabidopsis thaliana At5g56840 gene, complete cds.
GenBankBT0149560.0BT014956.1 Arabidopsis thaliana At5g56840 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200495.11e-173myb-like transcription factor family protein
SwissprotQ7XC573e-46MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A178UGL61e-171A0A178UGL6_ARATH; Uncharacterized protein
TrEMBLQ9FJS91e-171Q9FJS9_ARATH; At5g56840
STRINGAT5G56840.11e-172(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54962747
Representative plantOGRP3941699
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  3. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. M
    Genome-wide analysis of the Arabidopsis leaf transcriptome reveals interaction of phosphate and sugar metabolism.
    Plant Physiol., 2007. 143(1): p. 156-71
    [PMID:17085508]
  6. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]
  7. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  8. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]