PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G56110.1
Common NameAtMYB103, ATMYB80, MDA7.17, MS188, MYB103, MYB80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 320aa    MW: 35983.4 Da    PI: 7.3224
Description myb domain protein 103
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G56110.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.1e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
      AT5G56110.1 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding45.71.6e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++ E+ ++v+ +  lG++ W++Ia+ ++ gRt++++k++w++
      AT5G56110.1  68 GQFSEAEEHIIVKFHSVLGNR-WSLIAAQLP-GRTDNDVKNYWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.472965IPR017930Myb domain
SuperFamilySSF466893.01E-2911108IPR009057Homeodomain-like
SMARTSM007173.2E-141363IPR001005SANT/Myb domain
PfamPF002495.2E-181461IPR001005SANT/Myb domain
CDDcd001671.32E-111761No hitNo description
Gene3DG3DSA:1.10.10.609.6E-2465116IPR009057Homeodomain-like
SMARTSM007173.6E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.99466116IPR017930Myb domain
PfamPF002495.7E-1368110IPR001005SANT/Myb domain
CDDcd001671.77E-870112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000282anatomytrichome
PO:0009046anatomyflower
PO:0009071anatomyanther wall tapetum
PO:0025022anatomycollective leaf structure
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SEAEEHIIVK FHSVLGNRWS LIAAQLPGRT DNDVKNYWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEITTTL NPPQVSHLAE AALGCFKDEM LHLLTKKRVD LNQINFSNHN  180
PNPNNFHEIA DNEAGKIKMD GLDHGNGIMK LWDMGNGFSY GSSSSSFGNE ERNDGSASPA  240
VAAWRGHGGI RTAVAETAAA EEEERRKLKG EVVDQEEIGS EGGRGDGMTM MRNHHHHQHV  300
FNVDNVLWDL QADDLINHMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184238240.0
Genevisible248051_at0.0
Expression AtlasAT5G56110-
AtGenExpressAT5G56110-
ATTED-IIAT5G56110-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During anther development, expressed from stage 4 to stage 6 in microsporocytes and tapetal cells. At the tetrad stage, expressed predominantly in tapetal cells. During microgametogenesis, expression decreases radically in the tapetum and microspores. {ECO:0000269|PubMed:21957980}.
UniprotTISSUE SPECIFICITY: Expressed in the tapetum and middle layer of developing anthers (PubMed:10353220). Expressed in trichomes (PubMed:12848824). {ECO:0000269|PubMed:10353220, ECO:0000269|PubMed:12848824}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the R2R3 MYB transcription factor gene family that is required for anther development by regulation tapetum development, callose dissolution and exine formation. It acts upstream of MS2.
UniProtTranscription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269|PubMed:12848824, ECO:0000269|PubMed:17727613, ECO:0000269|PubMed:21673079}.
Function -- GeneRIF ? help Back to Top
  1. These results indicate that AtMYB103 is a crucial regulator of Arabidopsis anther development.
    [PMID: 21104372]
  2. Data suggest that the timing of tapetal programmed cell death is critical for pollen development, and the MYB80/UNDEAD system may regulate that timing.
    [PMID: 21673079]
  3. DYT1, TDF1 and AMS function in early tapetum development, while MS188 and MS1 are important for late tapetum development.
    [PMID: 21957980]
  4. Data show that the MYB80 homolog genes, driven by the AtMYB80 or their respective promoters, rescued the atmyb80 mutant, completely restoring male fertility.
    [PMID: 22086333]
  5. required for FERULATE-5-HYDROXYLASE expression and syringyl lignin biosynthesis
    [PMID: 22967312]
  6. The MYB80 homologs fused with the EAR repressor motif have been shown to induce male sterility in Arabidopsis.
    [PMID: 25311582]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G56110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A), AT1G71930 (A), AT2G46770 (A), AT3G28470 (A), AT3G61910 (A), AT5G62380 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G11980(A), AT5G22260(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDBrassinosteroid
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Male sterility due to distorted pollen grains lacking reticulate exine on their surface. {ECO:0000269|PubMed:17727613}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G56110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196390.0AY519639.1 Arabidopsis thaliana MYB transcription factor (At5g56110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200422.10.0myb domain protein 103
SwissprotQ9XHV00.0MYB80_ARATH; Transcription factor MYB80
TrEMBLM4CF650.0M4CF65_BRARP; Uncharacterized protein
STRINGAT5G56110.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MalvidsOGEM100052635
Publications ? help Back to Top
  1. Li SF,Higginson T,Parish RW
    A novel MYB-related gene from Arabidopsis thaliana expressed in developing anthers.
    Plant Cell Physiol., 1999. 40(3): p. 343-7
    [PMID:10353220]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Hanano S, et al.
    Analysis of gene expression in Arabidopsis thaliana by array hybridization with genomic DNA fragments aligned along chromosomal regions.
    Plant J., 2002. 30(2): p. 247-55
    [PMID:12000460]
  5. Higginson T,Li SF,Parish RW
    AtMYB103 regulates tapetum and trichome development in Arabidopsis thaliana.
    Plant J., 2003. 35(2): p. 177-92
    [PMID:12848824]
  6. Adham AR,Zolman BK,Millius A,Bartel B
    Mutations in Arabidopsis acyl-CoA oxidase genes reveal distinct and overlapping roles in beta-oxidation.
    Plant J., 2005. 41(6): p. 859-74
    [PMID:15743450]
  7. Cork JM,Purugganan MD
    High-diversity genes in the Arabidopsis genome.
    Genetics, 2005. 170(4): p. 1897-911
    [PMID:15911589]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Zhang W, et al.
    Regulation of Arabidopsis tapetum development and function by DYSFUNCTIONAL TAPETUM1 (DYT1) encoding a putative bHLH transcription factor.
    Development, 2006. 133(16): p. 3085-95
    [PMID:16831835]
  10. Zhang ZB, et al.
    Transcription factor AtMYB103 is required for anther development by regulating tapetum development, callose dissolution and exine formation in Arabidopsis.
    Plant J., 2007. 52(3): p. 528-38
    [PMID:17727613]
  11. Alves-Ferreira M, et al.
    Global expression profiling applied to the analysis of Arabidopsis stamen development.
    Plant Physiol., 2007. 145(3): p. 747-62
    [PMID:17905860]
  12. Zhu J, et al.
    Defective in Tapetal development and function 1 is essential for anther development and tapetal function for microspore maturation in Arabidopsis.
    Plant J., 2008. 55(2): p. 266-77
    [PMID:18397379]
  13. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  14. Zhu J, et al.
    AtMYB103 is a crucial regulator of several pathways affecting Arabidopsis anther development.
    Sci China Life Sci, 2010. 53(9): p. 1112-22
    [PMID:21104372]
  15. Phan HA,Iacuone S,Li SF,Parish RW
    The MYB80 transcription factor is required for pollen development and the regulation of tapetal programmed cell death in Arabidopsis thaliana.
    Plant Cell, 2011. 23(6): p. 2209-24
    [PMID:21673079]
  16. Zhu J,Lou Y,Xu X,Yang ZN
    A genetic pathway for tapetum development and function in Arabidopsis.
    J Integr Plant Biol, 2011. 53(11): p. 892-900
    [PMID:21957980]
  17. Phan HA,Li SF,Parish RW
    MYB80, a regulator of tapetal and pollen development, is functionally conserved in crops.
    Plant Mol. Biol., 2012. 78(1-2): p. 171-83
    [PMID:22086333]

  18. MYB103 is required for FERULATE-5-HYDROXYLASE expression and syringyl lignin biosynthesis in Arabidopsis stems.
    Plant J., 2013. 73(1): p. 63-76
    [PMID:22967312]
  19. Xu Y,Iacuone S,Li SF,Parish RW
    MYB80 homologues in Arabidopsis, cotton and Brassica: regulation and functional conservation in tapetal and pollen development.
    BMC Plant Biol., 2014. 14: p. 278
    [PMID:25311582]
  20. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]