PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G55690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 277aa    MW: 31700 Da    PI: 7.8413
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G55690.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF511.9e-161051243
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 ri n+  r +t+ kR++ + KKA+E S+LC+++ +vi+++++
  AT5G55690.1 10 RITNEKTRITTYKKRKACLYKKASEFSTLCGVDTCVIVYGPS 51
                 89**************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.825151IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-14160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-19297IPR002100Transcription factor, MADS-box
CDDcd002663.00E-28282No hitNo description
PRINTSPR004047.6E-7323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-171051IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020090anatomyembryo sac central cell
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGRKMVKMTR ITNEKTRITT YKKRKACLYK KASEFSTLCG VDTCVIVYGP SRAGDEMVME  60
PELWPKDGSK VREILTKYRD TASSSCTKTY TVQECLEKNN TKVEKPTIAT KYPTWDKKLD  120
QCSLNDLYAV FMAVENKIQE ATNRNQTFPD TSCWSNDQLG LCGYNRQCFE QYQLFPLPTM  180
DYNGLSFFPF NNQMTSNTAE VSSFSNVTEP MIANGQSLFY GSCSDGPYGP MVQRTAYMEP  240
IHWGLGNSMF NNVKQFQDYP FRFAQVNDLE DSSKLSM
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G55690
AtGenExpressAT5G55690
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G55690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G55690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0090500.0AB009050.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDF20.
GenBankAY1412140.0AY141214.1 Arabidopsis thaliana MADS-box protein AGL47 mRNA, complete cds.
GenBankBT0260420.0BT026042.1 Arabidopsis thaliana At5g55690 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001318803.10.0MADS-box transcription factor family protein
RefseqNP_200380.10.0MADS-box transcription factor family protein
SwissprotQ9FIM04e-47AGL82_ARATH; Agamous-like MADS-box protein AGL82
TrEMBLQ9FM690.0Q9FM69_ARATH; At5g55690
STRINGAT5G55690.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59481947
Representative plantOGRP3677621
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  6. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  8. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]