PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G53980.1
Common NameATHB52, ATHB-52, HB52, K19P17.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 156aa    MW: 17934.1 Da    PI: 7.985
Description homeobox protein 52
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G53980.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89e-191064256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                  k+ ++t++q+++Le++F +n+++  + + +L+++lgL++rqV vWFqN+Ra+ k
  AT5G53980.1 10 NKKKRLTQDQVRQLEKCFTMNKKLEPDLKLQLSNQLGLPQRQVAVWFQNKRARFK 64
                 67788************************************************98 PP

2HD-ZIP_I/II105.34.6e-3410102193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +kk+rl+++qv++LE++F++++kLep+ K +l+++Lgl +rqvavWFqn+RAR+kt+ lE+++ +L+++++a  +++++Le++v+ L++elk+
  AT5G53980.1  10 NKKKRLTQDQVRQLEKCFTMNKKLEPDLKLQLSNQLGLPQRQVAVWFQNKRARFKTQSLEVQHCTLQSKHEAALSDKAKLEHQVQFLQDELKR 102
                  59****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-18567IPR009057Homeodomain-like
PROSITE profilePS5007117.054666IPR001356Homeobox domain
SMARTSM003893.8E-17870IPR001356Homeobox domain
CDDcd000865.20E-15967No hitNo description
PfamPF000463.6E-161064IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.5E-181269IPR009057Homeodomain-like
PROSITE patternPS0002704164IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0007131developmental stageseedling development stage
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MENSQSQGKN KKKRLTQDQV RQLEKCFTMN KKLEPDLKLQ LSNQLGLPQR QVAVWFQNKR  60
ARFKTQSLEV QHCTLQSKHE AALSDKAKLE HQVQFLQDEL KRARNQLALF TNQDSPVDNS  120
NLGSCDEDHD DQVVVFDELY ACFVSNGHGS SSTSWV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.295230.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248208_at0.0
Expression AtlasAT5G53980-
AtGenExpressAT5G53980-
ATTED-IIAT5G53980-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and flowers. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G53980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G53980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0076440.0AB007644.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone: K19P17.
GenBankAK2292110.0AK229211.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-49-M21.
GenBankBT0159270.0BT015927.1 Arabidopsis thaliana At5g53980 mRNA, complete cds.
GenBankBT0219200.0BT021920.1 Arabidopsis thaliana At5g53980 gene, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200209.11e-112homeobox protein 52
SwissprotQ9FN291e-113ATB52_ARATH; Homeobox-leucine zipper protein ATHB-52
TrEMBLA0A178UF511e-107A0A178UF51_ARATH; HB52
STRINGAT5G53980.11e-111(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121072632
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  3. Oono Y, et al.
    Monitoring expression profiles of Arabidopsis genes during cold acclimation and deacclimation using DNA microarrays.
    Funct. Integr. Genomics, 2006. 6(3): p. 212-34
    [PMID:16463051]
  4. Che P,Lall S,Nettleton D,Howell SH
    Gene expression programs during shoot, root, and callus development in Arabidopsis tissue culture.
    Plant Physiol., 2006. 141(2): p. 620-37
    [PMID:16648215]
  5. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  6. Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
    Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance.
    Plant Physiol., 2007. 144(3): p. 1391-406
    [PMID:17478635]
  7. Xu K, et al.
    A genome-wide transcriptome profiling reveals the early molecular events during callus initiation in Arabidopsis multiple organs.
    Genomics, 2012. 100(2): p. 116-24
    [PMID:22664253]
  8. Markakis MN, et al.
    Identification of genes involved in the ACC-mediated control of root cell elongation in Arabidopsis thaliana.
    BMC Plant Biol., 2012. 12: p. 208
    [PMID:23134674]