PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G53660.1
Common NameAtGRF7, GRF7, MNC6.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRF
Protein Properties Length: 365aa    MW: 40410.3 Da    PI: 8.1837
Description growth-regulating factor 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G53660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.98.5e-24108151245
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                   epgrCrRtDGKkWRC ++v++++k+CE+Hlhrgr rsrk++e+
  AT5G53660.1 108 LEPGRCRRTDGKKWRCAKEVVSNHKYCEKHLHRGRPRSRKHVEP 151
                  69***************************************997 PP

2QLQ514.4e-185990233
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33
                 +FT+aQl +L++Q+++yKy++a+ PvP +Ll+
  AT5G53660.1 59 PFTNAQLKELERQAMIYKYMIASIPVPFDLLV 90
                 9*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.0E-115894IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.9445994IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-115989IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.345107151IPR014977WRC domain
PfamPF088795.9E-19109150IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0048366Biological Processleaf development
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020144anatomyapical meristem
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDFLKVSDKT TIPYRSDSLF SLNQQQYKES SFGFRDMEIH PHPTPYAGNG LLGCYYYYPF  60
TNAQLKELER QAMIYKYMIA SIPVPFDLLV SSPSSASPCN NKNIAGDLEP GRCRRTDGKK  120
WRCAKEVVSN HKYCEKHLHR GRPRSRKHVE PPYSRPNNNG GSVKNRDLKK LPQKLSSSSI  180
KDKTLEPMEV SSSISNYRDS RGSEKFTVLA TTEQENKYLN FIDVWSDGVR SSEKQSTTST  240
PVSSSNGNLS LYSLDLSMGG NNLMGQDEMG LIQMGLGVIG SGSEDHHGYG PYGVTSSLEE  300
MSSWLAPMST TPGGPLAEIL RPSTNLAISG DIESYSLMET PTPSSSPSRV MKKMTSSVSD  360
ESSQV
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248213_at0.0
Expression AtlasAT5G53660-
AtGenExpressAT5G53660-
ATTED-IIAT5G53660-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
Functional Description ? help Back to Top
Source Description
TAIRGrowth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Involved in leaf development and expressed in shoot and flower.
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. GRF7 binds to a region of the DREB2A promoter and represses its activity. GRF7 represses the expression of osmotic stress-responsive genes.
    [PMID: 22942381]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G53660.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G53660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1761090.0AK176109.1 Arabidopsis thaliana mRNA for putative protein, complete cds, clone: RAFL22-89-N21.
GenBankBT0108820.0BT010882.1 Arabidopsis thaliana At5g53660 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200177.10.0growth-regulating factor 7
SwissprotQ9FJB80.0GRF7_ARATH; Growth-regulating factor 7
TrEMBLA0A178UMM30.0A0A178UMM3_ARATH; GRF7
STRINGAT5G53660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121062731
Representative plantOGRP4601684
Publications ? help Back to Top
  1. Kim JH,Choi D,Kende H
    The AtGRF family of putative transcription factors is involved in leaf and cotyledon growth in Arabidopsis.
    Plant J., 2003. 36(1): p. 94-104
    [PMID:12974814]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Jones-Rhoades MW,Bartel DP
    Computational identification of plant microRNAs and their targets, including a stress-induced miRNA.
    Mol. Cell, 2004. 14(6): p. 787-99
    [PMID:15200956]
  4. Kim JH,Kende H
    A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(36): p. 13374-9
    [PMID:15326298]
  5. Knight CA, et al.
    Expression profiling and local adaptation of Boechera holboellii populations for water use efficiency across a naturally occurring water stress gradient.
    Mol. Ecol., 2006. 15(5): p. 1229-37
    [PMID:16626450]
  6. Tepperman JM,Hwang YS,Quail PH
    phyA dominates in transduction of red-light signals to rapidly responding genes at the initiation of Arabidopsis seedling de-etiolation.
    Plant J., 2006. 48(5): p. 728-42
    [PMID:17076805]
  7. Liu D,Song Y,Chen Z,Yu D
    Ectopic expression of miR396 suppresses GRF target gene expression and alters leaf growth in Arabidopsis.
    Physiol Plant, 2009. 136(2): p. 223-36
    [PMID:19453503]
  8. Rodriguez RE, et al.
    Control of cell proliferation in Arabidopsis thaliana by microRNA miR396.
    Development, 2010. 137(1): p. 103-12
    [PMID:20023165]
  9. Nelson DC, et al.
    Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100
    [PMID:20351290]
  10. Kim JS, et al.
    Arabidopsis growth-regulating factor7 functions as a transcriptional repressor of abscisic acid- and osmotic stress-responsive genes, including DREB2A.
    Plant Cell, 2012. 24(8): p. 3393-405
    [PMID:22942381]
  11. Liang G,He H,Li Y,Wang F,Yu D
    Molecular mechanism of microRNA396 mediating pistil development in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 249-58
    [PMID:24285851]
  12. Cao Y,Han Y,Jin Q,Lin Y,Cai Y
    Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).
    Front Plant Sci, 2016. 7: p. 1750
    [PMID:27933074]