PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G53040.1
Common NameGRD, MNB8.10, RKD4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 256aa    MW: 29896.1 Da    PI: 7.2723
Description RWP-RK domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G53040.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK832.8e-26145195252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ++++++++++++F+ pi +AAkeL+v+lTvLK++CR++GI RWPhRk+ksl
  AT5G53040.1 145 QDKLEMSEIKQFFDRPIMKAAKELNVGLTVLKKRCRELGIYRWPHRKLKSL 195
                  6799*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.791130216IPR003035RWP-RK domain
PfamPF020421.2E-21148195IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000200anatomymicropylar endosperm
PO:0000201anatomychalazal cyst
PO:0009009anatomyplant embryo
PO:0020090anatomyembryo sac central cell
PO:0020094anatomyplant egg cell
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MSSSKHSSVF NYSALFLSLF LQQMDQNSLH HLDSPKIENE YEPDSLYDML DKLPPLDSLL  60
DMEDLKPNAG LHFQFHYNSF EDFFENIEVD NTIPSDIHLL TQEPYFSSDS SSSSPLAIQN  120
DGLISNVKVE KVTVKKKRNL KKKRQDKLEM SEIKQFFDRP IMKAAKELNV GLTVLKKRCR  180
ELGIYRWPHR KLKSLNSLIK NLKNVGMEEE VKNLEEHRFL IEQEPDAELS DGTKKLRQAC  240
FKANYKRRKS LGDDYY
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184234630.0
Expression AtlasAT5G53040-
AtGenExpressAT5G53040-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G53040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G53040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0181160.0AB018116.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNB8.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200116.10.0RWP-RK domain-containing protein
SwissprotQ9LVU80.0RKD4_ARATH; Protein RKD4
TrEMBLA0A178UBS50.0A0A178UBS5_ARATH; RKD4
STRINGAT5G53040.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125852230
Representative plantOGRP5671777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  3. Koszegi D, et al.
    Members of the RKD transcription factor family induce an egg cell-like gene expression program.
    Plant J., 2011. 67(2): p. 280-91
    [PMID:21457369]
  4. Jeong S,Palmer TM,Lukowitz W
    The RWP-RK factor GROUNDED promotes embryonic polarity by facilitating YODA MAP kinase signaling.
    Curr. Biol., 2011. 21(15): p. 1268-76
    [PMID:21802295]
  5. Waki T,Hiki T,Watanabe R,Hashimoto T,Nakajima K
    The Arabidopsis RWP-RK protein RKD4 triggers gene expression and pattern formation in early embryogenesis.
    Curr. Biol., 2011. 21(15): p. 1277-81
    [PMID:21802301]
  6. Azpeitia E,Davila-Velderrain J,Villarreal C,Alvarez-Buylla ER
    Gene regulatory network models for floral organ determination.
    Methods Mol. Biol., 2014. 1110: p. 441-69
    [PMID:24395275]