PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G52510.1
Common NameSCL8, T4M5.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 640aa    MW: 69150.4 Da    PI: 4.8611
Description SCARECROW-like 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G52510.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.21.9e-1112666402374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +++++e+A+a+++g++e a+++Lar+s++ + ++++ ++l+ +++ AL++r+a+         p++e      +e+l +++l++e+sP++k+++ +aN
  AT5G52510.1 266 RQTVMEIATAIAEGKTEIATEILARVSQTPNLERNSEEKLVDFMVAALRSRIAS---------PVTELY---GKEHLISTQLLYELSPCFKLGFEAAN 351
                  6889**************************************************.........444444...899*********************** PP

         GRAS 100 qaIleavege...erv.HiiDfdisqGlQWpaLlqaLasRpeg......ppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnvl 181
                   aIl+a++++    ++ H+iDfdi++G+Q+++Ll++L++R++g      +p ++iT+v+++ +g       +e+l+++g+ L+++ ++lg++++fnv+
  AT5G52510.1 352 LAILDAADNNdggMMIpHVIDFDIGEGGQYVNLLRTLSTRRNGksqsqnSPVVKITAVANNVYGclvddgGEERLKAVGDLLSQLGDRLGISVSFNVV 449
                  **********9855569*********************999444555559**********99889999999**************************9 PP

         GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                  ++ rl dl+ e+L ++p+E+laVnl+++l+r++desv++e++rde+L+ vk+l+P+vv++veqe++ n+++Fl r++e++ +y al++s+e+++p+++
  AT5G52510.1 450 TSLRLGDLNRESLGCDPDETLAVNLAFKLYRVPDESVCTENPRDELLRRVKGLKPRVVTLVEQEMNSNTAPFLGRVSESCACYGALLESVESTVPSTN 547
                  999*********************************************************************************************** PP

         GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++r+kvE+  +gr++vn+vaceg +r+er+e ++kWr+r+++aGF+ +plsek+a+++k+  ++v+  g++v+e++g +++gW++r+L+++SaWr
  AT5G52510.1 548 SDRAKVEEG-IGRKLVNAVACEGIDRIERCEVFGKWRMRMSMAGFELMPLSEKIAESMKSRGNRVH-PGFTVKEDNGGVCFGWMGRALTVASAWR 640
                  *********.********************************************************.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.204239621IPR005202Transcription factor GRAS
PfamPF035146.5E-109266640IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MESGFSGGGG GSDFYGGGGG RSIPGGPGTV INVGNNNPQT TYRNQIPGIF FDQIGNRVAG  60
GNGFSGKRTL ADFQAAQQHQ QQQQQQPFYS QAALNAFLSR SVKPRNYQNF QSPSPMIDLT  120
SVNDMSLFGG SGSSQRYGLP VPRSQTQQQQ SDYGLFGGIR MGIGSGINNY PTLTGVPCIE  180
PVQNRVHESE NMLNSLRELE KQLLDDDDES GGDDDVSVIT NSNSDWIQNL VTPNPNPNPV  240
LSFSPSSSSS SSSPSTASTT TSVCSRQTVM EIATAIAEGK TEIATEILAR VSQTPNLERN  300
SEEKLVDFMV AALRSRIASP VTELYGKEHL ISTQLLYELS PCFKLGFEAA NLAILDAADN  360
NDGGMMIPHV IDFDIGEGGQ YVNLLRTLST RRNGKSQSQN SPVVKITAVA NNVYGCLVDD  420
GGEERLKAVG DLLSQLGDRL GISVSFNVVT SLRLGDLNRE SLGCDPDETL AVNLAFKLYR  480
VPDESVCTEN PRDELLRRVK GLKPRVVTLV EQEMNSNTAP FLGRVSESCA CYGALLESVE  540
STVPSTNSDR AKVEEGIGRK LVNAVACEGI DRIERCEVFG KWRMRMSMAG FELMPLSEKI  600
AESMKSRGNR VHPGFTVKED NGGVCFGWMG RALTVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2926464011375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.224120.0flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425684880.0
Genevisible248366_at1e-163
Expression AtlasAT5G52510-
AtGenExpressAT5G52510-
ATTED-IIAT5G52510-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G52510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G52510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAP0003780.0AP000378.1 Arabidopsis thaliana genomic DNA, chromosome 5, BAC clone:T4M5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200064.30.0scarecrow-like protein 8
SwissprotQ9FYR70.0SCL8_ARATH; Scarecrow-like protein 8
TrEMBLD7MS570.0D7MS57_ARALL; Putative uncharacterized protein
STRINGAT5G52510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43502856
Representative plantOGRP7599918
Publications ? help Back to Top
  1. Pysh LD,Wysocka-Diller JW,Camilleri C,Bouchez D,Benfey PN
    The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes.
    Plant J., 1999. 18(1): p. 111-9
    [PMID:10341448]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Zik M,Irish VF
    Global identification of target genes regulated by APETALA3 and PISTILLATA floral homeotic gene action.
    Plant Cell, 2003. 15(1): p. 207-22
    [PMID:12509532]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  7. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  8. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  9. Koroleva OA,Tomlinson ML,Leader D,Shaw P,Doonan JH
    High-throughput protein localization in Arabidopsis using Agrobacterium-mediated transient expression of GFP-ORF fusions.
    Plant J., 2005. 41(1): p. 162-74
    [PMID:15610358]
  10. Trinks D, et al.
    Suppression of RNA silencing by a geminivirus nuclear protein, AC2, correlates with transactivation of host genes.
    J. Virol., 2005. 79(4): p. 2517-27
    [PMID:15681452]
  11. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  12. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  13. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  14. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]