PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G52260.1
Common NameAtMYB19, MYB19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 268aa    MW: 31178.7 Da    PI: 7.6259
Description myb domain protein 19
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G52260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding361.6e-111461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l+  +   G  +W+t++   g+ R +k+c++rw +yl
      AT5G52260.1 14 KGLWSPEEDQKLKSFILSRGHACWTTVPILAGLQRNGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding55.51.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+e ++ ++  lG++ W++Ia++++ gRt++++k++w++yl
      AT5G52260.1  67 RGSFSEEEEETILTLHSSLGNK-WSRIAKYLP-GRTDNEIKNYWHSYL 112
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.359961IPR017930Myb domain
SuperFamilySSF466897.34E-2711108IPR009057Homeodomain-like
SMARTSM007173.2E-61363IPR001005SANT/Myb domain
PfamPF002497.7E-101461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-191568IPR009057Homeodomain-like
CDDcd001672.80E-51761No hitNo description
PROSITE profilePS5129425.98262116IPR017930Myb domain
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2669115IPR009057Homeodomain-like
CDDcd001673.36E-778112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MTKSGERPKQ RQRKGLWSPE EDQKLKSFIL SRGHACWTTV PILAGLQRNG KSCRLRWINY  60
LRPGLKRGSF SEEEEETILT LHSSLGNKWS RIAKYLPGRT DNEIKNYWHS YLKKRWLKSQ  120
PQLKSQISDL TESPSSLLSC GKRNLETETL DHVISFQKFS ENPTSSPSKE SNNNMIMNNS  180
NNLPKLFFSE WISSSNPHID YSSAFTDSKH INETQDQINE EEVMMINNNN YSSLEDVMLR  240
TDFLQPDHEY ANYYSSGDFF INSDQNYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25141157107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248343_at0.0
Expression AtlasAT5G52260-
AtGenExpressAT5G52260-
ATTED-IIAT5G52260-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at very low level. Expressed in cauline leaves. {ECO:0000269|PubMed:11581165}.
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
UniProtTranscription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}.
Function -- GeneRIF ? help Back to Top
  1. results indicate that the TaMYB19 protein plays an important role in plant stress tolerance and that modification of the expression of this protein may improve abiotic stress tolerance in crop plants
    [PMID: 25146486]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G52260.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G52260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196360.0AY519636.1 Arabidopsis thaliana MYB transcription factor (At5g52260) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200039.10.0myb domain protein 19
SwissprotQ9M0K41e-100LAF1_ARATH; Transcription factor LAF1
TrEMBLQ9LTJ50.0Q9LTJ5_ARATH; MYB transcription factor
STRINGAT5G52260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  6. Zhang L, et al.
    Characterization of a wheat R2R3-MYB transcription factor gene, TaMYB19, involved in enhanced abiotic stresses in Arabidopsis.
    Plant Cell Physiol., 2014. 55(10): p. 1802-12
    [PMID:25146486]
  7. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]