PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G51910.1
Common NameMJM18.6, TCP19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 293aa    MW: 31460.4 Da    PI: 7.5477
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G51910.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP117.61.6e-3650122173
          TCP   1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                  +a+k+ +++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl+ a+pai+e+tgt++ +a ++
  AT5G51910.1  50 PAPKRPTSKDRHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAEPAIIEATGTGTVPAIAV 122
                  5899*************************************************************88888444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.4E-3056133IPR005333Transcription factor, TCP
PROSITE profilePS5136927.55157111IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0031347Biological Processregulation of defense response
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MESNHEGNAI QVIDQVTTMT HLSDPNPKTK PGMMLMKQED GYLQPVKTKP APKRPTSKDR  60
HTKVEGRGRR IRMPAGCAAR VFQLTRELGH KSDGETIRWL LERAEPAIIE ATGTGTVPAI  120
AVSVNGTLKI PTSSPVLNDG GRDGDGDLIK KRRKRNCTSD FVDVNDSCHS SVTSGLAPIT  180
ASNYGVNILN VNTQGFVPFW PMGMGTAFVT GGPDQMGQMW AIPTVATAPF LNVGARPVSS  240
YVSNASDAEA EMETSGGGTT QPLRDFSLEI YDKRELQFLG GSGNSSPSSC HET
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149153KKRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.296520.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248385_at0.0
Expression AtlasAT5G51910-
AtGenExpressAT5G51910-
ATTED-IIAT5G51910-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00064PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G51910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G60970, AT5G62430, AT1G14920, AT1G24625, AT1G30210, AT1G35560, AT1G53230, AT1G58100, AT1G69690
IntActSearch Q9LT89
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G51910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256230.0AB025623.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJM18.
GenBankAK1185790.0AK118579.1 Arabidopsis thaliana At5g51910 mRNA for unknown protein, complete cds, clone: RAFL19-81-E01.
GenBankBT0087790.0BT008779.1 Arabidopsis thaliana At5g51910 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200004.10.0TCP family transcription factor
RefseqNP_851173.10.0TCP family transcription factor
SwissprotQ9LT890.0TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A178UCD40.0A0A178UCD4_ARATH; Uncharacterized protein
STRINGAT5G51910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125832530
Representative plantOGRP31781129
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Vandepoele K,Simillion C,Van de Peer Y
    Detecting the undetectable: uncovering duplicated segments in Arabidopsis by comparison with rice.
    Trends Genet., 2002. 18(12): p. 606-8
    [PMID:12446138]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Nawy T, et al.
    Transcriptional profile of the Arabidopsis root quiescent center.
    Plant Cell, 2005. 17(7): p. 1908-25
    [PMID:15937229]
  6. Aguilar-Martínez JA,Poza-Carrión C,Cubas P
    Arabidopsis BRANCHED1 acts as an integrator of branching signals within axillary buds.
    Plant Cell, 2007. 19(2): p. 458-72
    [PMID:17307924]
  7. Koo J, et al.
    A GUS/luciferase fusion reporter for plant gene trapping and for assay of promoter activity with luciferin-dependent control of the reporter protein stability.
    Plant Cell Physiol., 2007. 48(8): p. 1121-31
    [PMID:17597079]
  8. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  9. Mukhtar MS, et al.
    Independently evolved virulence effectors converge onto hubs in a plant immune system network.
    Science, 2011. 333(6042): p. 596-601
    [PMID:21798943]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  12. Danisman S, et al.
    Analysis of functional redundancies within the Arabidopsis TCP transcription factor family.
    J. Exp. Bot., 2013. 64(18): p. 5673-85
    [PMID:24129704]
  13. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  14. Wang X, et al.
    TCP transcription factors are critical for the coordinated regulation of isochorismate synthase 1 expression in Arabidopsis thaliana.
    Plant J., 2015. 82(1): p. 151-62
    [PMID:25702611]