PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G51780.1
Common NameBHLH36, EN6, MIO24.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bHLH
Protein Properties Length: 174aa    MW: 19929.3 Da    PI: 8.9179
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G51780.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH474.7e-15354255
                 HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH  2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                 +++h e Er+RR+++ s ++ Lr+llP  +   ++K s ++ + +Av+YIk+Lq
  AT5G51780.1  3 KMMHRETERQRRQEMASLYASLRSLLPLHF--IKGKRSTSDQVNEAVNYIKYLQ 54
                 789*************************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.354153IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.2E-11367IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.01E-10358No hitNo description
SuperFamilySSF474592.09E-14368IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.1E-12354IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003534.5E-7759IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0090575Cellular ComponentRNA polymerase II transcription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEKMMHRETE RQRRQEMASL YASLRSLLPL HFIKGKRSTS DQVNEAVNYI KYLQRKIKEL  60
SVRRDDLMVL SRGSLLGSSN GDFKEDVEMI SGKNHVVVRQ CLVGVEIMLS SRCCGGQPRF  120
SSVLQVLSEY GLCLLNSISS IVDDRLVYTI QAEVNDMALM IDLAELEKRL IRMK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.296610.0seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G51780
AtGenExpressAT5G51780
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed constitutively in roots, leaves, stems, and flowers. {ECO:0000269|PubMed:12679534}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G51780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FLI1
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G51780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3174300.0AK317430.1 Arabidopsis thaliana AT5G51780 mRNA, complete cds, clone: RAFL24-28-D24.
GenBankBT0109520.0BT010952.1 Arabidopsis thaliana At5g51780 mRNA, complete cds.
GenBankBT0116400.0BT011640.1 Arabidopsis thaliana At5g51780 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199991.11e-123basic helix-loop-helix (bHLH) DNA-binding superfamily protein
SwissprotQ9FLI11e-125BH036_ARATH; Transcription factor bHLH36
TrEMBLB9DH811e-122B9DH81_ARATH; AT5G51780 protein
STRINGAT5G51780.11e-123(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44792754
Representative plantOGRP1638838
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Heim MA, et al.
    The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity.
    Mol. Biol. Evol., 2003. 20(5): p. 735-47
    [PMID:12679534]
  3. Toledo-Ortiz G,Huq E,Quail PH
    The Arabidopsis basic/helix-loop-helix transcription factor family.
    Plant Cell, 2003. 15(8): p. 1749-70
    [PMID:12897250]
  4. Bailey PC, et al.
    Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana.
    Plant Cell, 2003. 15(11): p. 2497-502
    [PMID:14600211]
  5. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  7. Luhua S, et al.
    Linking genes of unknown function with abiotic stress responses by high-throughput phenotype screening.
    Physiol Plant, 2013. 148(3): p. 322-33
    [PMID:23517122]