PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G49490.1
Common NameAGL83
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 285aa    MW: 32425.9 Da    PI: 8.264
Description AGAMOUS-like 83
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G49490.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.54.5e-106092941
                 HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
       SRF-TF  9 rqvtfskRrngilKKAeELSvLCdaevaviifs 41
                   vt +kRr+g++ KA+ L+ L da++a++   
  AT5G49490.1 60 LRVTCTKRREGLFSKASQLCLLSDAQIAILATP 92
                 579*************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-1044107IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.8814489IPR002100Transcription factor, MADS-box
CDDcd002664.23E-1845121No hitNo description
SuperFamilySSF554555.23E-1446118IPR002100Transcription factor, MADS-box
PfamPF003197.8E-105494IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020090anatomyembryo sac central cell
PO:0025074anatomyembryo sac
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MRFVPYLYEI ERLWLSLVNY LSPRKNKNRR CGEIDKIRMV KKGGTKRKIA IETIQKSDYL  60
RVTCTKRREG LFSKASQLCL LSDAQIAILA TPPTSESNIS FYSFGHSSVD AVVSSFLSGQ  120
RCVPLQEDTK EMREDVAICL SRTNLGLGFW WNNESLNKSE NPQEISDAIN SMLTLLSNLK  180
ELSGEEALVN DHKDLKKNER SDVVLQHGTQ YETLNPNSNT TTICCVPDEL PANSNEIVGI  240
SPNPLIMLEK KKSQIEEKFE KEWQVSVTRI ENEATSSYAK RRRSI
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184230320.0
Expression AtlasAT5G49490-
AtGenExpressAT5G49490-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G49490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G49490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0230330.0AB023033.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone: K6M13.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199760.10.0AGAMOUS-like 83
TrEMBLQ9FGZ50.0Q9FGZ5_ARATH; AGAMOUS-like 83
STRINGAT5G49490.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Representative plantOGRP1084328
Publications ? help Back to Top
  1. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Zhang Y,Wu Y,Liu Y,Han B
    Computational identification of 69 retroposons in Arabidopsis.
    Plant Physiol., 2005. 138(2): p. 935-48
    [PMID:15923328]
  7. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]