PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G48670.1
Common NameAGL80, FEM111, K15N18.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 321aa    MW: 36824.5 Da    PI: 6.9302
Description AGAMOUS-like 80
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G48670.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.92.6e-181151343
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 i+n+s r+ tf kR++g++KK +ELS+LC++ ++ ii+s+ 
  AT5G48670.1 11 ISNDSSRKATFKKRKKGLMKKVHELSTLCGITACAIIYSPY 51
                 9**************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-25160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.465149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-25295IPR002100Transcription factor, MADS-box
CDDcd002666.00E-24285No hitNo description
PRINTSPR004042.1E-9323IPR002100Transcription factor, MADS-box
PfamPF003198.1E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009089anatomyendosperm
PO:0020090anatomyembryo sac central cell
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MTRKKVKLAY ISNDSSRKAT FKKRKKGLMK KVHELSTLCG ITACAIIYSP YDTNPEVWPS  60
NSGVQRVVSE FRTLPEMDQH KKMVDQEGFL KQRIAKATET LRRQRKDSRE LEMTEVMFQC  120
LIGNMEMFHL NIVDLNDLGY MIEQYLKDVN RRIEILRNSG TEIGESSSVA VAASEGNIPM  180
PNLVATTAPT TTIYEVGSSS SFAAVANFVN PIDLQQFRHP AAQHVGLNEQ PQNLNLNLNQ  240
NYNQNQEWFM EMMNHPEQMR YQTEQMGYQF MDDNHHNHIH HQPQEHQHQI HDESSNALDA  300
ANSSSIIPVT SSSITNKTWF H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYISNDSSRKATFKKRK
22125KKRKK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453590220.0
Genevisible248661_at0.0
Expression AtlasAT5G48670-
AtGenExpressAT5G48670-
ATTED-IIAT5G48670-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}.
Functional Description ? help Back to Top
Source Description
TAIRAGL80 is a member of the MADS box family of genes. AGL80 functions as a transcription factor within the central cell gene regulatory network and controls the expression of downstream genes required for central cell development and function.
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Function -- GeneRIF ? help Back to Top
  1. AGL80 functions as a transcription factor within the central cell gene regulatory network and controls the expression of downstream genes required for central cell development and function.
    [PMID: 16798889]
  2. The expression pattern and mutant phenotype of AGL61 are similar to those of AGL80, suggesting that AGL61 may function as a heterodimer with AGL80 within the central cell.
    [PMID: 18599653]
  3. Data show that AGL61 and AGL80 appear to function together to differentiate the central cell in Arabidopsis. Data renamed AGL61 DIANA, after the virginal Roman goddess of the hunt.
    [PMID: 18713950]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G48670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G22015(A), AT5G04560(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G60440
IntActSearch Q9FJK3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G48670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0154680.0AB015468.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K15N18.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankDQ0567100.0DQ056710.1 Arabidopsis thaliana MADS-box family protein (At5g48670) mRNA, complete cds.
GenBankDQ4067520.0DQ406752.1 Arabidopsis thaliana MADS box transcription factor AGL80 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199678.10.0AGAMOUS-like 80
SwissprotQ9FJK30.0AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A178UE430.0A0A178UE43_ARATH; FEM111
STRINGAT5G48670.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Portereiko MF, et al.
    AGL80 is required for central cell and endosperm development in Arabidopsis.
    Plant Cell, 2006. 18(8): p. 1862-72
    [PMID:16798889]
  7. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  8. Kang IH,Steffen JG,Portereiko MF,Lloyd A,Drews GN
    The AGL62 MADS domain protein regulates cellularization during endosperm development in Arabidopsis.
    Plant Cell, 2008. 20(3): p. 635-47
    [PMID:18334668]
  9. Steffen JG,Kang IH,Portereiko MF,Lloyd A,Drews GN
    AGL61 interacts with AGL80 and is required for central cell development in Arabidopsis.
    Plant Physiol., 2008. 148(1): p. 259-68
    [PMID:18599653]
  10. Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC
    The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules.
    Plant Cell, 2008. 20(8): p. 2088-101
    [PMID:18713950]
  11. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  13. Li HJ, et al.
    Arabidopsis CBP1 Is a Novel Regulator of Transcription Initiation in Central Cell-Mediated Pollen Tube Guidance.
    Plant Cell, 2015. 27(10): p. 2880-93
    [PMID:26462908]
  14. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]