PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G48250.1
Common NameBBX8, COL10, MIF21.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 373aa    MW: 41244.6 Da    PI: 5.9703
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G48250.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.93.1e-06444539
     zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                 +C+ ++e++   +C+++  +lC +C  + H+       H++
  AT5G48250.1  4 MCDFCGEQRSMVYCRSDAACLCLSCDRNVHSAnalskrHSR 44
                 6*****************************65677777765 PP

2zf-B_box23.31.3e-074691441
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg........Htvvp 41
                  +C++++ ++++  C d ++ lC++C  ++H g        H++++
  AT5G48250.1 46 LVCERCNAQPASVRCSDERVSLCQNCDWSGHDGknstttshHKRQT 91
                 68*****************************767788888777665 PP

3CCT59.51.2e-20316359144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R++a++RYkeK+k RkF+K++rY sRK++A+ R RvKGrFvk+ 
  AT5G48250.1 316 RNNAVMRYKEKKKARKFDKRVRYVSRKERADVRRRVKGRFVKSG 359
                  99***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.527147IPR000315B-box-type zinc finger
CDDcd000213.57E-7447No hitNo description
SMARTSM003363.7E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501199.5134392IPR000315B-box-type zinc finger
CDDcd000216.81E-64792No hitNo description
SMARTSM0033644892IPR000315B-box-type zinc finger
PROSITE profilePS5101715.1316358IPR010402CCT domain
PfamPF062032.4E-15316358IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020094anatomyplant egg cell
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD AACLCLSCDR NVHSANALSK RHSRTLVCER CNAQPASVRC  60
SDERVSLCQN CDWSGHDGKN STTTSHHKRQ TINCYSGCPS SAELSSIWSF CMDLNISSAE  120
ESACEQGMGL MTIDEDGTGE KSGVQKINVE QPETSSAAQG MDHSSVPENS SMAKELGVCE  180
DDFNGNLISD EVDLALENYE ELFGSAFNSS RYLFEHGGIG SLFEKDEAHE GSMQQPALSN  240
NASADSFMTC RTEPIICYSS KPAHSNISFS GITGESNAGD FQDCGASSMK QLSREPQPWC  300
HPTAQDIIAS SHATTRNNAV MRYKEKKKAR KFDKRVRYVS RKERADVRRR VKGRFVKSGE  360
AYDYDPMSPT RSY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.70800.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425683880.0
Genevisible248744_at0.0
Expression AtlasAT5G48250-
AtGenExpressAT5G48250-
ATTED-IIAT5G48250-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G48250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9LUA9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G48250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0399570.0AY039957.1 Arabidopsis thaliana unknown protein (At5g48250) mRNA, complete cds.
GenBankAY1426070.0AY142607.1 Arabidopsis thaliana unknown protein (At5g48250) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description