PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G47670.1
Common NameL1L, MNJ7.26, NFYB6, NF-YB6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YB
Protein Properties Length: 234aa    MW: 26136.3 Da    PI: 7.1789
Description nuclear factor Y, subunit B6
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G47670.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.21.3e-5456152197
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  vreqdrf+Pianv+rim+++lPa+akis+d+ket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yrelege+
  AT5G47670.1  56 VREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGER 152
                  69*********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.2E-5052153IPR009072Histone-fold
SuperFamilySSF471133.19E-3759152IPR009072Histone-fold
PfamPF008089.5E-2562126IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-1690108No hitNo description
PROSITE patternPS00685093109IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-16109127No hitNo description
PRINTSPR006151.1E-16128146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0004507developmental stageplant embryo bilateral stage
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MERGGFHGYR KLSVNNTTPS PPGLAANFLM AEGSMRPPEF NQPNKTSNGG EEECTVREQD  60
RFMPIANVIR IMRRILPAHA KISDDSKETI QECVSEYISF ITGEANERCQ REQRKTITAE  120
DVLWAMSKLG FDDYIEPLTL YLHRYRELEG ERGVSCSAGS VSMTNGLVVK RPNGTMTEYG  180
AYGPVPGIHM AQYHYRHQNG FVFSGNEPNS KMSGSSSGAS GARVEVFPTQ QHKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A1e-6455147597NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.491400.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248754_at0.0
Expression AtlasAT5G47670-
AtGenExpressAT5G47670-
ATTED-IIAT5G47670-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}.
UniprotTISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}.
Functional Description ? help Back to Top
Source Description
TAIREncodes LEC1-Like (L1L), closely related to LEC1 (Leafy Cotyledon1). Functions as a regulator of embryo development.
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}.
Function -- GeneRIF ? help Back to Top
  1. LEC1 and LEC1-LIKE activate the CRUCIFERIN C and SUCROSE SYNTHASE 2 (SUS2) promoters in combination with an NF-YC subunit through the interaction with a seed-specific ABA-response element (ABRE) binding bZIP factor, bZIP67. [L1L] [LEC1-LIKE]
    [PMID: 19207209]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G47670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G54830, AT1G56170
IntActSearch Q84W66
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Altered response to abscisic acid (ABA). {ECO:0000269|PubMed:17322342}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G47670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1384610.0AY138461.1 Arabidopsis thaliana leafy cotyledon 1-like L1L protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001318754.11e-177nuclear factor Y, subunit B6
RefseqNP_199578.21e-177nuclear factor Y, subunit B6
SwissprotQ84W661e-178NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A178UB791e-176A0A178UB79_ARATH; NF-YB6
STRINGAT5G47670.11e-176(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM98962636
Representative plantOGRP16817170
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  4. Ruuska SA,Girke T,Benning C,Ohlrogge JB
    Contrapuntal networks of gene expression during Arabidopsis seed filling.
    Plant Cell, 2002. 14(6): p. 1191-206
    [PMID:12084821]
  5. Kwong RW, et al.
    LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development.
    Plant Cell, 2003. 15(1): p. 5-18
    [PMID:12509518]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  8. Warpeha KM, et al.
    The GCR1, GPA1, PRN1, NF-Y signal chain mediates both blue light and abscisic acid responses in Arabidopsis.
    Plant Physiol., 2007. 143(4): p. 1590-600
    [PMID:17322342]
  9. Mu J, et al.
    LEAFY COTYLEDON1 is a key regulator of fatty acid biosynthesis in Arabidopsis.
    Plant Physiol., 2008. 148(2): p. 1042-54
    [PMID:18689444]
  10. Yamamoto A, et al.
    Arabidopsis NF-YB subunits LEC1 and LEC1-LIKE activate transcription by interacting with seed-specific ABRE-binding factors.
    Plant J., 2009. 58(5): p. 843-56
    [PMID:19207209]
  11. Le BH, et al.
    Global analysis of gene activity during Arabidopsis seed development and identification of seed-specific transcription factors.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(18): p. 8063-70
    [PMID:20385809]
  12. Tan H, et al.
    Enhanced seed oil production in canola by conditional expression of Brassica napus LEAFY COTYLEDON1 and LEC1-LIKE in developing seeds.
    Plant Physiol., 2011. 156(3): p. 1577-88
    [PMID:21562329]
  13. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  14. Calvenzani V, et al.
    Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
    PLoS ONE, 2012. 7(8): p. e42902
    [PMID:22912760]
  15. Jia H,McCarty DR,Suzuki M
    Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression.
    Plant Physiol., 2013. 163(3): p. 1293-305
    [PMID:24043445]
  16. Kim HU, et al.
    Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues.
    FEBS Open Bio, 2013. 4: p. 25-32
    [PMID:24363987]
  17. Sato H, et al.
    Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.
    Plant Cell, 2014. 26(12): p. 4954-73
    [PMID:25490919]
  18. Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
    Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
    Mol Plant, 2017. 10(4): p. 645-648
    [PMID:27871811]
  19. Li D, et al.
    MYB89 Transcription Factor Represses Seed Oil Accumulation.
    Plant Physiol., 2017. 173(2): p. 1211-1225
    [PMID:27932421]
  20. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  21. Han JD, et al.
    Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program.
    Front Plant Sci, 2017. 8: p. 439
    [PMID:28421087]