PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G47660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 398aa    MW: 45575.1 Da    PI: 5.9406
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G47660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix84.81.1e-26303384185
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                  rW+++ev+aLi  r+++ee+ + +  k++ W+e+s++m+erg+ers+k+Ckekwen+nk+y++++eg +k+ +e+s+t +yf++l
  AT5G47660.1 303 RWPQEEVQALISSRSDVEEKTGIN--KGAIWDEISARMKERGYERSAKKCKEKWENMNKYYRRVTEGGQKQ-PEHSKTRSYFEKL 384
                  8******************99988..99*****************************************95.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0023300360IPR001005SANT/Myb domain
SuperFamilySSF466893.4E-6301392IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-5302358IPR009057Homeodomain-like
CDDcd122034.22E-23302365No hitNo description
PfamPF138374.5E-20302384No hitNo description
PROSITE profilePS500907.422303358IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MELLAGDCRK RVGDDFEEDI NPFDGSDGGC GWMYGTRQMG SNGNDDALAT LADLASPPQK  60
LKPIRCGVKL PSSSEDRHPL DILAGTLDRL PEMGFGCFEA PLGSKIADVE ESGQLTRGFS  120
KEEDDSLPPL QMEFQARNRI SWDGLSLSSS VDSSDSDSSP DVRKTVTGKR KRETRVKLEH  180
FLEKLVGSMM KRQEKMHNQL INVMEKMEVE RIRREEAWRQ QETERMTQNE EARKQEMARN  240
LSLISFIRSV TGDEIEIPKQ CEFPQPLQQI LPEQCKDEKC ESAQREREIK FRYSSGSGSS  300
GRRWPQEEVQ ALISSRSDVE EKTGINKGAI WDEISARMKE RGYERSAKKC KEKWENMNKY  360
YRRVTEGGQK QPEHSKTRSY FEKLGNFYKT ISSGEREK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.298840.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184228240.0
Expression AtlasAT5G47660-
AtGenExpressAT5G47660-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00552DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G47660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G47660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0256280.0AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199577.10.0DNA-binding protein-like protein
TrEMBLQ9FGJ10.0Q9FGJ1_ARATH; DNA-binding protein-like protein
STRINGAT5G47660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94112736
Representative plantOGRP1130157
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  3. Bowen AJ, et al.
    PAH-domain-specific interactions of the Arabidopsis transcription coregulator SIN3-LIKE1 (SNL1) with telomere-binding protein 1 and ALWAYS EARLY2 Myb-DNA binding factors.
    J. Mol. Biol., 2010. 395(5): p. 937-49
    [PMID:19962994]
  4. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]