PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G47390.1
Common NameMYBH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 365aa    MW: 39670.9 Da    PI: 6.5656
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G47390.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.63e-1397141347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
      AT5G47390.1  97 PWTEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKY 141
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.515320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.4490146IPR017930Myb domain
SuperFamilySSF466892.01E-1792147IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-1893145IPR006447Myb domain, plants
SMARTSM007173.6E-1194144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-1194140IPR009057Homeodomain-like
CDDcd001672.70E-997142No hitNo description
PfamPF002497.0E-1197141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MTRRCSHCNH NGHNSRTCPN RGVKLFGVRL TEGSIRKSAS MGNLSHYTGS GSGGHGTGSN  60
TPGSPGDVPD HVAGDGYASE DFVAGSSSSR ERKKGTPWTE EEHRMFLLGL QKLGKGDWRG  120
ISRNYVTTRT PTQVASHAQK YFIRQSNVSR RKRRSSLFDM VPDEVGDIPM DLQEPEEDNI  180
PVETEMQGAD SIHQTLAPSS LHAPSILEIE ECESMDSTNS TTGEPTATAA AASSSSRLEE  240
TTQLQSQLQP QPQLPGSFPI LYPTYFSPYY PFPFPIWPAG YVPEPPKKEE THEILRPTAV  300
HSKAPINVDE LLGMSKLSLA ESNKHGESDQ SLSLKLGGGS SSRQSAFHPN PSSDSSDIKS  360
VIHAL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.233920.0floral meristem| flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425683690.0
Genevisible248795_at0.0
Expression AtlasAT5G47390-
AtGenExpressAT5G47390-
ATTED-IIAT5G47390-
Function -- GeneRIF ? help Back to Top
  1. These results indicate that MYBH is one of the molecular components that regulate hypocotyl elongation in response to darkness.
    [PMID: 23888064]
  2. KUA1 modulates leaf cell expansion and final organ size by controlling reactive oxygen species homeostasis.
    [PMID: 24806884]
  3. results suggest that the role of MYBH in controlling auxin homeostasis accounts for its capacity to participate in regulation of age- and darkness-induced leaf senescence in Arabidopsis
    [PMID: 25920996]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G47390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G47390
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195160.0AY519516.1 Arabidopsis thaliana MYB transcription factor (At5g47390) mRNA, complete cds.
GenBankAY0966610.0AY096661.1 Arabidopsis thaliana putative Myb-related transcription activator (At5g47390) mRNA, complete cds.
GenBankAY0842950.0AY084295.1 Arabidopsis thaliana clone 102806 mRNA, complete sequence.
GenBankAY0720770.0AY072077.1 Arabidopsis thaliana putative Myb-related transcription activator protein (At5g47390) mRNA, complete cds.
GenBankAK2269310.0AK226931.1 Arabidopsis thaliana mRNA for Myb-related transcription activator-like, complete cds, clone: RAFL09-26-D04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199550.10.0myb-like transcription factor family protein
TrEMBLQ9LVS00.0Q9LVS0_ARATH; MYB transcription factor
STRINGAT5G47390.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34262759
Representative plantOGRP3941699
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Nawy T, et al.
    Transcriptional profile of the Arabidopsis root quiescent center.
    Plant Cell, 2005. 17(7): p. 1908-25
    [PMID:15937229]
  3. Li Y, et al.
    Establishing glucose- and ABA-regulated transcription networks in Arabidopsis by microarray analysis and promoter classification using a Relevance Vector Machine.
    Genome Res., 2006. 16(3): p. 414-27
    [PMID:16424108]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Town CD, et al.
    Comparative genomics of Brassica oleracea and Arabidopsis thaliana reveal gene loss, fragmentation, and dispersal after polyploidy.
    Plant Cell, 2006. 18(6): p. 1348-59
    [PMID:16632643]
  6. Usadel B, et al.
    Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
    Plant Physiol., 2008. 146(4): p. 1834-61
    [PMID:18305208]
  7. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  8. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]
  9. Kwon Y, et al.
    A novel Arabidopsis MYB-like transcription factor, MYBH, regulates hypocotyl elongation by enhancing auxin accumulation.
    J. Exp. Bot., 2013. 64(12): p. 3911-22
    [PMID:23888064]
  10. Lu D,Wang T,Persson S,Mueller-Roeber B,Schippers JH
    Transcriptional control of ROS homeostasis by KUODA1 regulates cell expansion during leaf development.
    Nat Commun, 2014. 5: p. 3767
    [PMID:24806884]
  11. Huang CK, et al.
    A single-repeat MYB transcription repressor, MYBH, participates in regulation of leaf senescence in Arabidopsis.
    Plant Mol. Biol., 2015. 88(3): p. 269-86
    [PMID:25920996]